seo site checkup logo
PricingFree ToolsArticles
Report generated 3 months ago
https://bbvinos.com/store
Your general SEO Checkup Score
Archived
68/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 68 out of 100, which is below the average score of 75. However, there are 21 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
21 Failed
4 Warnings
48 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 66
Failed: 6
Warnings: 2
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: BBVinos Wine & Spirits
Length: 22 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: BBVinos es una tienda especializada en vinos premium, destilados, licores, productos de delicatessen, entre otros, orientado a todo consumidor que sabe de calidad entre estos productos.
Length: 185 characters
Google Search Results Preview Test
Desktop version
https://bbvinos.com/store/BBVinos Wine & SpiritsBBVinos es una tienda especializada en vinos premium, destilados, licores, productos de delicatessen, entre otros, orientado a todo consumidor que sabe de calidad entre estos productos.
Mobile version
https://bbvinos.com/store/BBVinos Wine & SpiritsBBVinos es una tienda especializada en vinos premium, destilados, licores, productos de delicatessen, entre otros, orientado a todo consumidor que sabe de calidad entre estos productos.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
BBVinos Wine & Spirits
og:url
https://bbvinos.com/store/
og:site_name
BB Vinos
og:description
BBVinos es una tienda especializada en vinos premium, destilados, licores, productos de delicatessen, entre otros, orientado a todo consumidor que sabe de calidad entre estos productos.
og:type
website
og:image
https://bbvinos.com/store/img/logo-1736427338.jpg
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
63carrito59vino59inicio59añadir54santa
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
carrito
vino
inicio
añadir
santa
Keywords Cloud Test
americanandesantiyalapaltaguaarestiarmiditaañadirbaronbauzabbvinosbodegasboldosbrutcaballocabernetcaliterracarmencarmenerecarritocasacasablancacasaschandonchateauchilechilenoscloscolorcoloresconchaconocordilleracruzdomingaemilianaensamblajeespumantesevanfamilyfelipefincafrancoisginebrahighlandiniciojohnnielapostolleleydalocoluislurtonluxardomaculmaltmanentmarquesmartinmartinomateticmezcalmitjansmontesmorandeoutletpedroperezphilippepiedrapirquepiscoquintaritarothschildsantasauvignonscotchsensussilvasingletiendatintotorotorrestresundurragavaldiviesovalleventisquerovinovinosviñamarviñasvodkawalkerwhiskywildwilliamwilliamswinewines
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
BBVINOS TIENDA ONLINE
H2 tags
Destacados
Vino Baettig Los Primos Pinot Noir 2022
Emiliana GE ENS (750ml 14%) 2018
Vino Santa Rita Pewen de Apalta Carmenere
Vino Viu Manent Infinito Ensamblaje
Vino Requingua Potro de Piedra, Ensamblaje
Tierras Moradas Carmenere (750ml 14.9%) 2021
Santa Rita Triple C, Ensamblaje
Vino Almaviva Epu Ensamblaje 2019
Vino Tarapaca Etiqueta Negra Cabernet Sauvignon
Caballo Loco Grand Cru Apalta, Ensamblaje
Vino Casa Silva S38, Cabernet Sauvignon
Vino Montes Purple Angel Carmenere
Vino Perez Cruz Limited Edition Cabernet Franc
Vino Los Boldos Grand Clos Ensamblaje
Vino Emiliana Coyam Organico 2020
Vendimia 2025
Vino Parra Family Trane Cinsault 2021
Vino Fuy Todo va a estar bien Riesling
Vino Bodegas RE Syranoir
Vino Kudaw Pacifico Carmenere
Vino Peñalolen, Cabernet Sauvignon
Vino Leo Erazo Amigo Piedra Cinsault
Vino Garage Wine Co. Parcelas VYRD Pirque Vineyard, Cabernet Franc
Vino OWM Marianena Carmenere
Vino Jp Martin Rumay Carmenere
Vino Laberinto Cenizas Sauvignon Blanc
Vino Tinto De Rulo Malbec.
Vino A Los Viñateros Bravos Onda Brava Pais.
Vino Petits Zorro Correteado Carmenere
Vino Huaso de Sauzal Garnacha
Vino Attilio and Mochi Sucre Ensamblaje
Coctelería
Pisco Alto del Carmen Especial (1000ml). Pisco de Elqui
Wild Hibiscus -Flor, 11 unidades
Pisco Mal Paso Reservado Transparente. Pisco de Limari
Espumante Valdivieso Limited Brut
Ron Pampero Aniversario (70cl, 40%), Ron de Venezuela
Mezcal 400 Conejos Joven
Vermouth Cocchi Storico
Ron Mitjans Blanco (1000ml)
Ron Diplomatico Reserva Exclusiva, Venezuela
Jerez Mitjans Zalamero
Armidita Primer Encanto, Pisco del Huasco
Mezcal Ojo de Tigre Joven
Espumante Desalcoholizado Viñamar Zero
Gin Boolton DRY 1000 ml
Licor Luxardo Limoncello. Licor dulce
Whiskys
Whisky Akashi Single Malt (500ml)
Whisky Johnnie Walker Swing. Scotch Whisky
Whisky Macallan 12 años Double Cask. Speyside Whisky
Whisky The Famous Grouse Finest. Scotch Whisky
Whisky Glenmorangie 18 Y Extremely Rare. Highland Whisky
Evan Williams Single Barrel, American Whiskey
Whisky Four Roses Small Batch
Lagavulin 16 Y (700ml 43%), Islay Whisky
The Balvenie 12 Y (700ml 40%), Speyside Whisky
Cragganmore 12 Y (700ml 40%), Speyside Whisky
Whisky Caol Ila 12 Y. Islay Whisky
Johnnie Walker Gold Label Reserve (750ml 40%), Scotch Whisky
Highland Park 12 Y - Viking Honour (700ml 40%), Island Whisky
Laphroaig 10 Y (700ml 40%), Islay Whisky
Nikka All Malt (700ml 40%), Japanese Single Malt
Lunes a Viernes7.00 a 16.00 hrs
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test83% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
SEO Friendly URL Test29% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test75% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 53
Failed: 10
Warnings: 1
Passed: 14
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 10,188 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using zstd compression on your code. The HTML code is compressed from 1017.63 Kb to 70.09 Kb (93% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 12.36 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
69.4 %
2.73 Mb
javascript
21.1 %
848.58 Kb
font
5.1 %
207.25 Kb
css
2.7 %
108.89 Kb
html
1.6 %
65.35 Kb
other
0.1 %
3.55 Kb
TOTAL
100%
3.93 Mb
Requests by content type
Content type
Percent
Requests
javascript
32.8 %
38
image
30.2 %
35
css
27.6 %
32
other
4.3 %
5
font
3.4 %
4
html
1.7 %
2
TOTAL
100%
116
Content size by domain
Domain
Percent
Size
bbvinos.com
82.5 %
3.24 Mb
static.zdassets.com
8.0 %
324.08 Kb
unpkg.com
2.2 %
87.31 Kb
connect.facebook.net
2.1 %
83.65 Kb
maps.googleapis.com
1.8 %
73.77 Kb
maps.gstatic.com
1.6 %
65.66 Kb
fonts.gstatic.com
0.9 %
35.20 Kb
ajax.googleapis.com
0.7 %
29.94 Kb
google.com
0.0 %
1.67 Kb
fonts.googleapis.com
0.0 %
1.38 Kb
Other
0.1 %
2.41 Kb
TOTAL
100%
3.93 Mb
Requests by domain
Domain
Percent
Requests
bbvinos.com
81.0 %
94
maps.googleapis.com
4.3 %
5
static.zdassets.com
3.4 %
4
fonts.googleapis.com
1.7 %
2
connect.facebook.net
1.7 %
2
fonts.gstatic.com
1.7 %
2
ajax.googleapis.com
0.9 %
1
facebook.com
0.9 %
1
google.com
0.9 %
1
maps.gstatic.com
0.9 %
1
Other
2.6 %
3
TOTAL
100%
116
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.615 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.615 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 10.041 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

10.041 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 11.66 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

11.66 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img class="swiper-slide-image swiper-lazy swiper-lazy-loaded" width="1740" height="519" src="https://bbvinos.com/store/img/cms/2025/BlackBBVino..." alt="BlackWeek">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 86
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "bbvinos.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
bbvinos.com
Subject Alternative Names (SANs)
bbvinos.com, *.bbvinos.com
Not valid before
Sat, February 1o 2025, 6:08:30 pm (z)
Not valid after
Fri, May 2o 2025, 7:06:51 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Intermediate certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Root certificate
Common name
GTS Root R4
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved