seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
http://amitytechnologies.in
Your general SEO Checkup Score
Archived
61/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 61 out of 100, which is below the average score of 75. However, there are 21 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
21 Failed
4 Warnings
45 Passed
Common SEO issues
Score: 44
Failed: 10
Warnings: 2
Passed: 14
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 18 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Amity Technologies
Length: 18 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 42 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Creative Agency, Marketing Agency Template
Length: 42 characters
Google Search Results Preview Test
Desktop version
http://amitytechnologies.inAmity TechnologiesCreative Agency, Marketing Agency Template
Mobile version
http://amitytechnologies.inAmity TechnologiesCreative Agency, Marketing Agency Template
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
19website14services13development9service7designing
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not appearing in one or more of the meta-tags above! Primary keywords should appear in meta-tags to help identify the topic of a webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud Test
affordableagencyamityandroidapplicationavailablebannerbestblogbrochurebulkbusinessbusinessescasecheaperclientscompanycompetitiveconditionscontactcreativecustomcustomersdelivereddeliveringdesigndesigningdetailsdevelopmentdigitaldomaindomainsecommerceemailestablishedfirmgatewaygraphicgridhappyhelpinghomehostinghoursiconindustriesintegrationlatestlearnlogomagentomarketingmediamembersnewsofferoffersopencartoptimizedpackpackagespaymentplatformsportfoliopricepricesprintprivacyproductsprojectsprovideprovidedqualityregistrationreliablerobustsecureserviceservicesshowcasesinglesocialsolutionsstaticstudysuccessfullysupportteamtechnologiestermstimeuniqueviewwebsitewebsiteswordpressworkworkedyearyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Creative Web Development Company
H2 tags
About Us
Our Design & Development Services
Our Latest Creative Work
Some of our Clients
Helping Businesses in All Domains
Have Question? Write a Message
Robots.txt Test94% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test75% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is not connected with social media using the API's provided by Facebook, Google +, Twitter, Pinterest, or using addthis.com
Speed optimizations
Score: 75
Failed: 5
Warnings: 1
Passed: 16
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 5.68 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,885 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 31.05 Kb to 5.68 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage is around 2.57 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
53.6 %
895.50 Kb
javascript
27.2 %
454.71 Kb
other
9.1 %
151.48 Kb
font
6.4 %
106.58 Kb
css
3.2 %
53.32 Kb
html
0.5 %
8.44 Kb
TOTAL
100%
1.63 Mb
Requests by content type
Content type
Percent
Requests
image
53.3 %
56
javascript
26.7 %
28
css
7.6 %
8
font
6.7 %
7
other
3.8 %
4
html
1.9 %
2
TOTAL
100%
105
Content size by domain
Domain
Percent
Size
amitytechnologies.in
50.5 %
843.51 Kb
maps.googleapis.com
19.4 %
323.18 Kb
cdnjs.cloudflare.com
8.9 %
148.72 Kb
google.com
7.7 %
128.12 Kb
fonts.gstatic.com
6.4 %
106.58 Kb
maps.gstatic.com
4.4 %
74.19 Kb
ajax.googleapis.com
1.9 %
31.00 Kb
khms0.googleapis.com
0.7 %
11.72 Kb
fonts.googleapis.com
0.2 %
3.02 Kb
TOTAL
100%
1.63 Mb
Requests by domain
Domain
Percent
Requests
amitytechnologies.in
59.0 %
62
maps.googleapis.com
14.3 %
15
google.com
10.5 %
11
fonts.gstatic.com
6.7 %
7
fonts.googleapis.com
2.9 %
3
maps.gstatic.com
2.9 %
3
cdnjs.cloudflare.com
1.9 %
2
ajax.googleapis.com
1.0 %
1
khms0.googleapis.com
1.0 %
1
TOTAL
100%
105
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 0.75 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.75 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Creative Web Development Company Amity Technologies is an established Website D...
Html: <section class="hero-section bg-gradient">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.075. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0753

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Creative Web Development Company Amity Technologies is an established Website D...
Html: <div class="text-block">
Score: 0.0753
Server and security
Score: 59
Failed: 4
Warnings: 0
Passed: 5
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 52
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.mx.hostinger.com include:relay.mailchannels.net ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved