seo site checkup logo
PricingFree ToolsArticles
Report generated 4 days ago
https://WWW.DERMEASESTORE.COM
Your general SEO Checkup Score
Archived
69/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 69 out of 100, which is below the average score of 75. However, there are 17 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
17 Failed
6 Warnings
51 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 64
Failed: 6
Warnings: 3
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Premium Skincare and Beauty Products - Dermease Store
Length: 53 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 240 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Discover a wide range of premium skincare and beauty products at Dermease Store. From facial care to anti-aging solutions, explore high-quality products designed to enhance your skincare routine. Shop now for the best in skincare and beauty
Length: 240 characters
Google Search Results Preview Test
Desktop version
https://www.dermeasestore.com/Premium Skincare and Beauty Products - Dermease StoreDiscover a wide range of premium skincare and beauty products at Dermease Store. From facial care to anti-aging solutions, explore high-quality products designed to enhance your skincare routine. Shop now for the best in skincare and beauty
Mobile version
https://www.dermeasestore.com/Premium Skincare and Beauty Products - Dermease StoreDiscover a wide range of premium skincare and beauty products at Dermease Store. From facial care to anti-aging solutions, explore high-quality products designed to enhance your skincare routine. Shop now for the best in skincare and beauty
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:title
Premium Skincare and Beauty Products - Dermease Store
og:description
Discover a wide range of premium skincare and beauty products at Dermease Store. From facial care to anti-aging solutions, explore high-quality products designed to enhance your skincare routine. Shop now for the best in skincare and beauty
og:url
https://www.dermeasestore.com/
og:site_name
Dermease Store
og:image
https://cdn.shopify.com/s/files/1/0703/9559/2943/files/Derm_Ease_Logo_75dc415d-fff3-4125-8ac9-bc119a8fb7d5.png?v=1721468729
og:image:secure_url
https://cdn.shopify.com/s/files/1/0703/9559/2943/files/Derm_Ease_Logo_75dc415d-fff3-4125-8ac9-bc119a8fb7d5.png?v=1721468729
og:image:width
613
og:image:height
493
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
226skin114hair80face61wash43read
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
skin
hair
face
wash
read
Keywords Cloud Test
acidacneagingantiapplebabybathbestbodybrightenbrightenscarecellscoffeecommentcompactcomplexioncontrolcreamdamagedandruffdarkdeaddeepdeeplydelightfuldermeasedirtdryingeaseeffectiveeffectivelyexcessfacefastfightsfragrancefragrancesfreefriendlygermsglowglowinggrowthhairhandhealthhealthyhelpshydratedhydrateshydrationimprovesimpuritiesitemkeepskojiclastinglineslonglotionmoisturizemoisturizednaturalofferporespreventpromotesprotectionprovideprovidesradiantreadreducereducesremoveremovessanitizerscalpscrubsellerserumshampooshopskinsmoothsoftspotsspraystickystrawberrysuitabletexturetonetraveltypesvinegarvitaminwashwrinkles
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
SHOP BY CATEGORY
H2 tags
What are you looking for?
BATH & BODY CARE
Offer Ends Soon!
Recommendation
OUR HAPPY CLIENT'S
FAQ's
RECENT BLOG
Practical Tips on How to Detan Your Skin for ...
Effective Strategies for Removing Sun Tan and...
Discovering the Wonders of Multani Mitti Bene...
Say Goodbye to Tired Eyes: Introducing Derm E...
Derm Ease 2% Kojic Acid Face Serum: Your Dail...
Boost Your Immunity and Glow From Within with...
Glow Daily with DermEase: The Ultimate CSMS S...
Erase Tan, Embrace Glow with DermEase D-Tan F...
Natural Onion Shampoo for Hair Growth
Mischief Spray for Women for Long Fragrance
Best Hair Wax for Strong Hold and Shine
Multani Mitti Face Wash for Clear Glowing
Retinol Face Wash for Clear and Youthful
Moist Ease Lotion Hydrate and Protect Skin
Green Apple Gel Scrub for Radiant Skin
Charcoal Peel Off Face Mask for Clear Skin
Orange Walnut Gel Scrub for Radiant Skin
Haldi & Chandan Face Wash for Glowing Skin
Vitamin C Gel Face Wash for Clean & Glow
Coffee Scrub for Face: Glow & Blackheads
Coffee Lotion: Hydration & Skin Glow Boost
Procapil Hair Serum: Strengthen & Grow Hair
Stay Fresh Naturally with Park Deodorant
D Tan Pack Get Clear Bright Skin with De Tan ...
Clean & Effective 5% Caffeine Eye Serum
Gentle Care & Gifts: The Perfect Baby Shampoo...
Tea Tree Face Serum 2025: Tea Tree Oil Benefi...
Kojic Acid Face Serum 2025: Reduce Dark Spots...
2025 Ubtan Face Pack: Best DIY Beauty Care fo...
Sun Screen SPF 70 Spray 2025: Best Sunscreen ...
Calo Ease Lotion Soothe Muscles and Nourish S...
Aloe Moisturizing Lotion for Soft, Radiant Skin
Your Ultimate Guide to BB+ Cream: Find the Be...
Dry Shampoo Benefits: Organic, Residue-Free, ...
Brighten Skin: Rice Face Wash for Glow & Deep...
Rejuvenate Your Skin with Effective Face Clea...
Subscribe and Save
Quick Links
Shop
Categories
Policy's
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test29% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test10% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test75% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 71
Failed: 6
Warnings: 2
Passed: 17
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 8,274 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 1081.62 Kb to 113.48 Kb (90% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 10.48 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
66.2 %
5.16 Mb
javascript
26.3 %
2.05 Mb
font
2.8 %
224.92 Kb
html
2.2 %
177.16 Kb
css
1.8 %
143.05 Kb
other
0.6 %
50.86 Kb
TOTAL
100%
7.79 Mb
Requests by content type
Content type
Percent
Requests
image
62.3 %
182
javascript
18.8 %
55
css
7.2 %
21
other
6.5 %
19
font
3.8 %
11
html
1.4 %
4
TOTAL
100%
292
Content size by domain
Domain
Percent
Size
dermeasestore.com
70.1 %
5.46 Mb
cdn.shopify.com
11.8 %
941.15 Kb
code.tidio.co
5.0 %
399.92 Kb
gstatic.com
3.3 %
263.14 Kb
googletagmanager.com
3.1 %
249.08 Kb
script.pop-convert.com
1.5 %
120.51 Kb
sr-cdn.shiprocket.in
1.3 %
102.49 Kb
connect.facebook.net
1.1 %
85.74 Kb
fonts.gstatic.com
0.8 %
60.62 Kb
google.com
0.5 %
42.57 Kb
Other
1.5 %
122.21 Kb
TOTAL
100%
7.79 Mb
Requests by domain
Domain
Percent
Requests
dermeasestore.com
78.1 %
228
cdn.shopify.com
7.5 %
22
fonts.gstatic.com
2.4 %
7
code.tidio.co
2.1 %
6
gstatic.com
1.0 %
3
sr-cdn.shiprocket.in
1.0 %
3
cdn-app.cart-bot.net
0.7 %
2
google-analytics.com
0.7 %
2
google.com
0.7 %
2
connect.facebook.net
0.7 %
2
Other
5.1 %
15
TOTAL
100%
292
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using cache headers for all JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test100% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.847 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.847 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.683 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.683 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.11 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.11 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img srcset="//www.dermeasestore.com/cdn/shop/files/combo_1920x..." src="//www.dermeasestore.com/cdn/shop/files/combo_1920x..." data-src="//www.dermeasestore.com/cdn/shop/files/combo_1920x..." alt="" class="img-fluid desk-img ls-is-cached lazyloaded" width="1920" height="750.0" decoding="async" loading="lazy" sizes="100vw">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0115. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0115

0.1

0.25

DOM element which contributes the most to CLS score:
Text: EPITOME OF SKIN CARE Embrace your beauty elevate your confidence! Shop Now
Html: <div class="swiper-slide slide-slide_KLMWgf swiper-slide-dupli..." data-swiper-slide-index="0" style="width: 1920px;" role="group" aria-label="1 / 4">
Score: 0.0088
Server and security
Score: 72
Failed: 3
Warnings: 0
Passed: 7
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.dermeasestore.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.dermeasestore.com
Subject Alternative Names (SANs)
www.dermeasestore.com
Not valid before
Wed, June 4o 2025, 7:30:24 am (z)
Not valid after
Tue, September 2o 2025, 8:30:14 am (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Intermediate certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Root certificate
Common name
GTS Root R4
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=7889238
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test95% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 60
Failed: 2
Warnings: 1
Passed: 7
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.dermeasestore.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.dermeasestore.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved