seo site checkup logo
PricingFree ToolsArticles
Report generated 8 days ago
https://DeferredConcepts.com
Your general SEO Checkup Score
Archived
81/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 81 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
3 Warnings
48 Passed
Issues to fix
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 56
Failed: 7
Warnings: 2
Passed: 13
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 68 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Tax Preparation and Small Business Services - Deferred Concepts, LLC
Length: 68 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 43 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Tax Preparation and Small Business Services
Length: 43 characters
Google Search Results Preview Test
Desktop version
https://deferredconcepts.com/Tax Preparation and Small Business Services - Deferred Concepts, LLCTax Preparation and Small Business Services
Mobile version
https://deferredconcepts.com/Tax Preparation and Small Business Services - Deferred Concepts, LLCTax Preparation and Small Business Services
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:url
https://deferredconcepts.com/
og:site_name
A Veteran Owned Limited Liability Company
og:title
A Veteran Owned Limited Liability Company
og:description
IRS Solutions LLC Startup and Positioning Income Tax Prep in your Home or Our Office
og:type
website
og:image
https://img1.wsimg.com/isteam/ip/0a60d6aa-a32d-4c1b-b832-d4385188cd68/blob-2ca497d.png
og:locale
en_US
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
9veteran9owned9company8limited8liability
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
veteran
owned
company
limited
liability
Keywords Cloud Test
appointmentsavailablebabyblogcompanyconceptsconditionscontactcopyrightdeferredemailemailsgettinghavinghellohomeincomeinformationissuesliabilitylimitedlongmarriednoticeofficeownedpolicypositioningpoweredprepprivacyreceivedreservedrightsservicessetupsolutionsspecialstartupsubscribetaxestermstexttodayupdateuptodateveteranwelcomeyear
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Deferred Concepts, LLC
H2 tags
Welcome
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html;charset=utf-8
Speed optimizations
Score: 98
Failed: 1
Warnings: 0
Passed: 19
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 21.21 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 238 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 110.02 Kb to 21.21 Kb (81% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 0.92 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
46.4 %
227.27 Kb
font
34.3 %
168.00 Kb
image
10.7 %
52.54 Kb
html
8.6 %
42.21 Kb
css
0.0 %
0 B
other
0.0 %
0 B
TOTAL
100%
490.03 Kb
Requests by content type
Content type
Percent
Requests
javascript
66.7 %
26
font
20.5 %
8
image
7.7 %
3
html
5.1 %
2
css
0.0 %
0
other
0.0 %
0
TOTAL
100%
39
Content size by domain
Domain
Percent
Size
img1.wsimg.com
91.4 %
447.82 Kb
deferredconcepts.com
8.6 %
42.21 Kb
TOTAL
100%
490.03 Kb
Requests by domain
Domain
Percent
Requests
img1.wsimg.com
94.9 %
37
deferredconcepts.com
5.1 %
2
TOTAL
100%
39
CDN Usage Test95% of top 100 sites passed
  • This webpage is not using images, javascript or css resources from same domain!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • This webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is not using render-blocking resources.
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.019 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.019 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.696 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.696 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.7 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.7 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img data-ux="HeaderMediaImage" src="//img1.wsimg.com/isteam/ip/0a60d6aa-a32d-4c1b-b832..." data-ht="Blur" data-aid="BACKGROUND_IMAGE_RENDERED" class="x-el x-el-img c1-1 c1-2 c1-4 c1-14 c1-10 c1-11 c1-...">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0013. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0013

0.1

0.25

DOM element which contributes the most to CLS score:
Text: HOME OUR SERVICES ABOUT US BLOG CONTACT US
Html: <div data-ux="Block" class="x-el x-el-div c1-1 c1-2 c1-15 c1-t c1-4o c1-b c1-c...">
Score: 0.0004
Server and security
Score: 89
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "deferredconcepts.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
deferredconcepts.com
Subject Alternative Names (SANs)
deferredconcepts.com, www.deferredconcepts.com
Not valid before
Fri, August 1o 2025, 1:32:28 am (z)
Not valid after
Wed, September 2o 2026, 1:32:28 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Secure Certificate Authority - G2
Intermediate certificate
Common name
Go Daddy Secure Certificate Authority - G2
Organization
GoDaddy.com, Inc.
Location
Scottsdale, Arizona, US
Not valid before
Tue, May 3o 2011, 7:00:00 am (z)
Not valid after
Sat, May 3o 2031, 7:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Root Certificate Authority - G2
Root certificate
Common name
Go Daddy Root Certificate Authority - G2
Organization
GoDaddy.com, Inc.
Location
Scottsdale, Arizona, US
Not valid before
Tue, September 1o 2009, 12:00:00 am (z)
Not valid after
Thu, December 31o 2037, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Go Daddy Root Certificate Authority - G2
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=63072000; includesubdomains; preload
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 1
Warnings: 1
Passed: 7
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.em.secureserver.net include:secureserver.net -all
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved