seo site checkup logo
PricingFree ToolsArticles
Report generated 2 months ago
http://103.31.13.36
Your general SEO Checkup Score
Archived
64/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 64 out of 100, which is below the average score of 75. However, there are 27 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
27 Failed
4 Warnings
41 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Switching to HTTPS is highly recommended by search engines to improve website rankings, even for sites that don't collect sensitive customer information.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
Connect your webpage with social media networks using APIs or AddThis, as social signals are becoming increasingly important for search engines to validate a site's trustworthiness and authority.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
HTTP/2 protocol offers several key improvements, including faster page load times, improved performance, better security and more efficient use of network resources.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Consider adding cache headers for JavaScript resources to speed up the webpage for returning users.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Consider adding cache headers for images to improve website performance. With cache headers, browsers can cache images and serve them quickly to returning visitors, rather than re-fetching them each time.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Consider adding cache headers for CSS resources to speed up the webpage for returning users.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
For security reasons, it is recommended to turn off the server signature.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 43
Failed: 8
Warnings: 2
Passed: 12
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 77 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: 스포츠중계 맘모스티비 - 해외축구중계, 고화질중계, 실시간스포츠중계사이트, EPL중계, NBA중계, MLB중계, 해축중계, 챔피언스리그중계
Length: 77 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 100 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: 스포츠중계 무료는 맘모스티비에서! 해외축구중계, MLB중계, NBA중계, EPL중계 등 다양한 스포츠를 고화질 실시간으로 시청하세요. 경기 하이라이트와 결과도 신속하게 제공합니다.
Length: 100 characters
Google Search Results Preview Test
Desktop version
http://103.31.13.36/스포츠중계 맘모스티비 - 해외축구중계, 고화질중계, 실시간스포츠중계사이트, EPL중계, NBA중계, MLB중계, 해축중계, 챔피언스리그중계스포츠중계 무료는 맘모스티비에서! 해외축구중계, MLB중계, NBA중계, EPL중계 등 다양한 스포츠를 고화질 실시간으로 시청하세요. 경기 하이라이트와 결과도 신속하게 제공합니다.
Mobile version
http://103.31.13.36/스포츠중계 맘모스티비 - 해외축구중계, 고화질중계, 실시간스포츠중계사이트, EPL중계, NBA중계, MLB중계, 해축중계, 챔피언스리그중계스포츠중계 무료는 맘모스티비에서! 해외축구중계, MLB중계, NBA중계, EPL중계 등 다양한 스포츠를 고화질 실시간으로 시청하세요. 경기 하이라이트와 결과도 신속하게 제공합니다.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
맘모스티비 - 무료 스포츠중계, 해외축구중계, 고화질 실시간 중계 사이트
og:url
https://www.mmtv00.com
og:type
website
og:description
해외축구, NBA, MLB, EPL 등 다양한 스포츠를 고화질로 실시간 무료중계! 맘모스티비에서 최신 경기 하이라이트와 결과까지 한눈에 확인하세요.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
18없습니다16게시글이8스포츠중계8있습니다7회원가입
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
없습니다
게시글이
스포츠중계
있습니다
회원가입
Keywords Cloud Test
copyrightlivemailmmmthtvreservedrightstelegramwkbl가입경로건전하고게시글이게시하면서고객센터고화질로공유하고공유함으로써공지사항공휴일은농구중계대회중계데이터를라이브스코어맘모스tv맘모스tv는맘모스tv만의맘모스tv에서맘모스tv에서는먹튀검증을명예의전당무료스포츠중계바로가기보상합니다보증업체부탁드립니다분데스리가분석가가빠른팁존사이트에서사이트입니다상담시간새댓글이서비스이용약관수년간의스코어보드스포츠분석스포츠중계스포츠중계a스포츠중계b스포츠중계c스포츠토토스포츠토토를스포츠하이라이트실시간으로실시간채팅싶으시거나아시안게임아시안컵야구중계업체소개업체소개영상없습니다영상묘청유로파리그일본야구일일포인트있습니다자동로그인자유게시판자유게시판에재미있게적중률의제공하고제휴종료진행하여챔피언스리그축구중계출석체크친구추가카지노사이트와커뮤니티토토사이트토토사이트를패스워드페이지도프로농구프리메라리가픽스터분석하이라이트하이라이트를해외축구회원가입회원님들께회원님들의회원들분석후기게시판휴일안내
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 67
Failed: 8
Warnings: 1
Passed: 11
HTML Page Size Test23% of top 100 sites passed
  • The size of this webpage's HTML is 15.25 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 840 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 102.75 Kb to 15.25 Kb (85% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 4.57 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
font
45.9 %
3.06 Mb
image
45.9 %
3.06 Mb
javascript
4.1 %
278.99 Kb
css
2.4 %
162.52 Kb
other
1.5 %
101.19 Kb
html
0.3 %
21.89 Kb
TOTAL
100%
6.66 Mb
Requests by content type
Content type
Percent
Requests
image
73.8 %
253
html
9.3 %
32
font
9.3 %
32
javascript
5.0 %
17
css
1.7 %
6
other
0.9 %
3
TOTAL
100%
343
Content size by domain
Domain
Percent
Size
gtype.winner-stream.com
36.0 %
2.40 Mb
cdn.jsdelivr.net
21.8 %
1.45 Mb
fastly.jsdelivr.net
17.4 %
1.16 Mb
103.31.13.36
12.0 %
820.67 Kb
fonts.gstatic.com
8.2 %
562.46 Kb
fonts.googleapis.com
1.3 %
91.11 Kb
client.uchat.io
1.1 %
74.14 Kb
stackpath.bootstrapcdn.com
0.6 %
40.27 Kb
cdnjs.cloudflare.com
0.5 %
37.25 Kb
code.jquery.com
0.4 %
29.75 Kb
Other
0.6 %
39.32 Kb
TOTAL
100%
6.66 Mb
Requests by domain
Domain
Percent
Requests
gtype.winner-stream.com
71.1 %
244
103.31.13.36
12.2 %
42
fonts.gstatic.com
8.2 %
28
client.uchat.io
2.3 %
8
cdn.jsdelivr.net
2.0 %
7
cdnjs.cloudflare.com
1.2 %
4
stackpath.bootstrapcdn.com
0.6 %
2
code.jquery.com
0.3 %
1
fonts.googleapis.com
0.3 %
1
wcs.naver.net
0.3 %
1
Other
1.5 %
5
TOTAL
100%
343
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
See results list
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using cache headers for JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for CSS resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.212 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.212 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.261 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.261 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.31 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.31 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img class="w-100" src="img/bg/standby-bg.png">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0136. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0136

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0135
Server and security
Score: 32
Failed: 4
Warnings: 0
Passed: 3
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, shrink-to-fit=no" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 29
Failed: 3
Warnings: 1
Passed: 5
Structured Data Test66% of top 100 sites passed
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved