seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://www.meagherspharmacy.ie
Your general SEO Checkup Score
Archived
66/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 66 out of 100, which is below the average score of 75. However, there are 17 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
17 Failed
6 Warnings
47 Passed
Issues to fix
HIGH
To provide a good user experience, sites should aim for a Cumulative Layout Shift score of 0.1 or less.
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 64
Failed: 5
Warnings: 4
Passed: 16
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 70 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Meaghers Health and Beauty Pharmacy Dublin Ireland — Meaghers Pharmacy
Length: 70 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 99 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Meaghers Pharmacy, leading online beauty, makeup and cosmetics products. Free treat in every order.
Length: 99 characters
Google Search Results Preview Test
Desktop version
https://www.meagherspharmacy.ie/Meaghers Health and Beauty Pharmacy Dublin Ireland — Meaghers PharmacyMeaghers Pharmacy, leading online beauty, makeup and cosmetics products. Free treat in every order.
Mobile version
https://www.meagherspharmacy.ie/Meaghers Health and Beauty Pharmacy Dublin Ireland — Meaghers PharmacyMeaghers Pharmacy, leading online beauty, makeup and cosmetics products. Free treat in every order.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
Meaghers Pharmacy
og:url
https://www.meagherspharmacy.ie/
og:title
Meaghers Health and Beauty Pharmacy Dublin Ireland
og:type
website
og:description
Meaghers Pharmacy, leading online beauty, makeup and cosmetics products. Free treat in every order.
og:image
https://cdn.shopify.com/s/files/1/0035/4523/5569/files/Meaghers_logo_1204x630.jpg?v=1665140021
og:image:secure_url
https://cdn.shopify.com/s/files/1/0035/4523/5569/files/Meaghers_logo_1204x630.jpg?v=1665140021
og:image:width
1204
og:image:height
630
og:image:alt
Social media image
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
32view30skincare29cookies27cart26skin
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
view
skincare
cookies
cart
skin
Keywords Cloud Test
acidactivactiveadvancedadviceallowavenebadgebeautybodyboostbossbrandbrandsbrushcarecartcleanmarinecoliefcomputationcookiescreamcurrentdailydanielledetailserroreyesfabüfaceformulatedfragrancefreegiftgiftshaircarehealthheliocarehushhyaluronhyaluronichydrationimageinfinityinformationingredientslabellineliquidmakeupmeaghersmedicinemineralmoisturisersmultimuradnutritionoffersonlineoraloriginalperformancepharmacypluspriceprivacyproductprogrammeprovenresultssaveserumservicesshopsiteskinskincareskinceuticalsskingredientsskinlabsnippetsspotlightstoresundaysupplementsupplementssupportsymproveteethultrasunveganvichyviewvitaminvitaminsweekwellbeingwhiteningwishlistyonka
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Meaghers Pharmacy
H2 tags
Symprove 12-Week Programme ( 8 + 4 free)
Symprove 4 Week Supply
Salin Plus Breathe Easy Salt Therapy
YourZooki Liposomal Vitamin C 30 (1000mg) Sachets
Revive Active Health Food Supplement 30 Sachets
fabÜ R&R Relax 60 Capsules
Advanced Nutrition Programme Skin Accumax 180 Capsules
fabÜ SHROOMS IMMUNE 60 Capsules
Avene Tolerance Hydra-10 Hydrating Fluid 40ml
Avene Hydrance Boost Hydrating Serum 30ml
Avene Tolerance Hydra-10 Moisturising Cream 40ml
Avene Hydrance Light Hydrating Emulsion 40ml
Avene Makeup Removing Micellar Gel 200ml
Avene Hyaluron Activ B3 Triple Correction Eye Cream 15ml
Avene Hyaluron Activ B3 Cellular Renewal Cream 50ml
Avene Hyaluron Activ B3 Multi-Intensive Night Cream 40ml
Spotlight Oral Care Toothpaste For Whitening Teeth
Spotlight Oral Care Sonic Toothbrush Replacement Heads
Spotlight Oral Care Floss Picks for Whitening Teeth
Cleanmarine Menomin 60 Capsules
Digital Thermometer With Automatic Alarm
Colief Vitamin D3 Drops 20ml
Spotlight Oral Care Toothpaste For Total Care
Spotlight Oral Care Mouthwash For Whitening Teeth
Popular Collections
Meaghers Recommends
Product of the Week!
Vichy Minéral 89 72 Hr Hyaluronic Acid Moisture Boosting Cream
What our customers say
Meaghers blog
Celebrating World Microbiome Day: Everything you need to know about the microbiome
What is best hayfever treatment for you?
Brands you love
ABOUT Chevron down icon
SUPPORT Chevron down icon
PRIVACY Chevron down icon
10% OFF YOUR FIRST ORDER
Checkmark icon Added to your cart:
Cookies
Privacy Preference Center
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 48
Failed: 10
Warnings: 1
Passed: 12
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 17,459 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 1130.29 Kb to 163.14 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 7.87 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
52.1 %
3.20 Mb
javascript
38.9 %
2.39 Mb
html
3.1 %
193.66 Kb
font
2.5 %
158.40 Kb
css
2.3 %
146.84 Kb
other
1.0 %
64.78 Kb
TOTAL
100%
6.14 Mb
Requests by content type
Content type
Percent
Requests
image
48.0 %
147
javascript
33.3 %
102
other
9.8 %
30
css
4.6 %
14
font
2.3 %
7
html
2.0 %
6
TOTAL
100%
306
Content size by domain
Domain
Percent
Size
cdn.shopify.com
50.2 %
3.08 Mb
cdn.cookielaw.org
13.9 %
872.92 Kb
images.loox.io
11.1 %
696.91 Kb
googletagmanager.com
2.7 %
167.95 Kb
meagherspharmacy.ie
2.7 %
166.96 Kb
ajax.googleapis.com
2.4 %
148.03 Kb
loox.io
2.1 %
130.67 Kb
swymv3free-01.azureedge.net
1.8 %
115.77 Kb
analytics.tiktok.com
1.8 %
114.92 Kb
appointment-booking-client.acerill.com
1.4 %
89.89 Kb
Other
9.9 %
624.21 Kb
TOTAL
100%
6.14 Mb
Requests by domain
Domain
Percent
Requests
cdn.shopify.com
51.3 %
157
images.loox.io
8.2 %
25
meagherspharmacy.ie
5.9 %
18
cdn.cookielaw.org
3.9 %
12
widget.trustpilot.com
2.0 %
6
static.klaviyo.com
1.6 %
5
loox.io
1.6 %
5
fonts.shopifycdn.com
1.3 %
4
hatscripts.github.io
1.3 %
4
script.crazyegg.com
1.3 %
4
Other
21.6 %
66
TOTAL
100%
306
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test99% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using cache headers for all JavaScript resources! Setting cache headers can help to speed up the webpage for returning users.
See results list
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test93% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 2.29 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.29 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class=" slideshow-background slid..." style=" background-image: url('//cdn.shopi..." data-themecolor="#636363" data-slidecolor="#ffffff">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 1.178. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

1.1782

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Best Sellers New In Offers $222.68 Symprove 12-Week Programme ( 8 + 4 free)  (1,...
Html: <div id="shopify-section-template--14311909556337__107d351e..." class="shopify-section">
Score: 0.4811
Server and security
Score: 90
Failed: 2
Warnings: 0
Passed: 8
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.meagherspharmacy.ie" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.meagherspharmacy.ie
Subject Alternative Names (SANs)
www.meagherspharmacy.ie
Not valid before
Tue, May 16o 2023, 8:08:25 pm (z)
Not valid after
Mon, August 14o 2023, 8:08:24 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R3
Intermediate certificate
Common name
R3
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=7889238
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 8
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.meagherspharmacy.ie/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.meagherspharmacy.ie/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:blacknight.ie include:amazonses.com include:spf.mailanyone.net include:spf.protection.outlook.com -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved