seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
https://patternie-wgljffciij.now.sh
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 101 out of 100, which is higher than the average score of 75. Our analysis has identified 11 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
0 Warnings
29 Passed
Common SEO issues
Score: 50
Failed: 4
Warnings: 0
Passed: 8
Google Search Results Preview
Desktop version
https://patternie-wgljffciij.now.sh/Patternie - Your best buddy to find you a neat patternPatternie - Your best buddy to find you a neat pattern
Mobile version
https://patternie-wgljffciij.now.sh/Patternie - Your best buddy to find you a neat patternPatternie - Your best buddy to find you a neat pattern
Keywords Cloud
a.m.a.z.i.n.gandroidbackgroundimagebackgroundrepeatcheckclipboardcoolcopydecentdownloaddragdropemailencounteredenterepcshterrorfilesimagelatestlinklooksmetalassedmydivnewsletterniceynotifypatternpatterniepatternsproductproductsrepeatrobotsendshinysubmitsubscribesubtlethat'stileabletypeupdateduploaduploadingurl("pattern.pngwe’ll
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test
  • Your webpage has 47 'img' tags and none of them contain the required 'alt' attribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Speed optimizations
Score: 85
Failed: 2
Warnings: 0
Passed: 4
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 31.42 Kb to 3.10 Kb (90 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 1.425 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 53
  • 2 HTML Pages
  • 7 CSS Files
  • 11 JS Files
  • 33 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 0
Failed: 1
Warnings: 0
Passed: 1
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 60
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
SPF Records Checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved