seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.worldfree4u.lol
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 105 out of 100, which is higher than the average score of 75. Our analysis has identified 11 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
3 Warnings
34 Passed
Common SEO issues
Score: 73
Failed: 3
Warnings: 2
Passed: 12
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: Worldfree4u.com - Download 300MB Movies Dual Audio Online Full HD
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: WorldFree4u 300MB Movies free download Latest Bollywood Hollywood Dual Audio Hindi Dubbed online single resumable link worldfree4u.com official site
Google Search Results Preview
Desktop version
https://www.worldfree4u.lolWorldfree4u.com - Download 300MB Movies Dual Audio Online Full HDWorldFree4u 300MB Movies free download Latest Bollywood Hollywood Dual Audio Hindi Dubbed online single resumable link worldfree4u.com official site
Mobile version
https://www.worldfree4u.lolWorldfree4u.com - Download 300MB Movies Dual Audio Online Full HDWorldFree4u 300MB Movies free download Latest Bollywood Hollywood Dual Audio Hindi Dubbed online single resumable link worldfree4u.com official site
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
30posted22november21hindi18movie14comments
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
aamiracharyaactionadityaadventureamitabhaudienceaudiencesaudiobachchanblockbusterbollywoodbomberbonanzabringingbrripcastcommentscrimedatedeadlydecemberdhoomdirecteddirectordoesdoubledragonsdramadualdubbedempressenglishepisodeesubsexperienceexpertfamilyfilmfilmmakingfriendsgamesgenregirlgroupshdriphindihindostanholdshorrorizmerkaalokaifkatrinakhankilledkrishnaladailargerleonslifeloremagesmakingmoviemoviesnamednovemberpdvdpostedprofionratingsreleasedrulesavinasavrillesceptersearchseenshowssivasongsstarstorylinesynopsistaqdeerteamsthievesthugstimetreatvictorvijayvillagewantsworkworkingwriteryearsyoung
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H1 tags. H1 tags should re-inforce the intended topic of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 5 H1 tags.
H1 tags
WorldFree4u.com
Thugs Of Hindostan (2018) 425MB 480P Pdvd Hindi Movie
Thugs Of Hindostan (2018) 700MB Pdvd Hindi Movie
Thugs Of Hindostan (2018) 1.35GB 720P Pdvd Hindi Movie
Bigg Boss 12 (2018) 8th November Episode 53 HDTV – 480P, 576P, 720P
Riverdale Season 03 Episode 04 (2018) WEB-DL 720P 350MB ESubs
Ladai Taqdeer Ki (2018) 300MB 480P HDRip Hindi Dubbed – Uncut
Ladai Taqdeer Ki (2018) 800MB 720P HDRip Hindi Dubbed
Kaalo (2010) 275MB 480P HDRip Hindi Movie
Kaalo (2010) 800MB 720P HDRip Hindi Movie
The Specialist (1994) 350MB 480P BRRip Dual Audio [Hindi-English]
The Specialist (1994) 850MB 720P BRRip Dual Audio [Hindi-English]
Dungeons & Dragons (2000) 325MB 480P BRRip Dual Audio [Hindi-English]
Dungeons & Dragons (2000) 850MB 720P BRRip Dual Audio [Hindi-English]
The Other Side of the Wind (2018) WEB-DL 480P 350MB English ESubs
The Other Side of the Wind (2018) WEB-DL 720P 1GB English ESubs
worldfree4u
H2 tags
worldfree4u.com
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Deprecated HTML Tags
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
4center57font
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 58
Failed: 3
Warnings: 1
Passed: 4
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 30.39 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 131.8 Kb to 30.39 Kb (77% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 3.16 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 55
  • 1 HTML Pages
  • 1 CSS Files
  • 17 JS Files
  • 36 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using cache headers for all of your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 3
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.worldfree4u.lol is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.worldfree4u.lol/" rel="canonical"/>
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved