seo site checkup logo
PricingFree ToolsArticles
Report generated 7 months ago
https://www.specsavers.co.uk
Your general SEO Checkup Score
Archived
87/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 87 out of 100, which is higher than the average score of 75. Our analysis has identified 16 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
16 Failed
2 Warnings
54 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Add a Viewport Meta Tag to optimize this webpage for mobile screens. Without a viewport meta tag, mobile devices may render pages at typical desktop screen widths, resulting in pages being scaled down and difficult to read.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Using social media meta tags can improve the appearance and content of shared links on social media platforms, potentially increasing click-through rates and engagement with the page.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 62
Failed: 5
Warnings: 2
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Welcome to Specsavers Opticians | Specsavers UK
Length: 47 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 147 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Find your local Specsavers store to book an appointment online. Why not buy / browse glasses & contact lenses online or try our FREE hearing check?
Length: 147 characters
Google Search Results Preview Test
Desktop version
https://www.specsavers.co.uk/Welcome to Specsavers Opticians | Specsavers UKFind your local Specsavers store to book an appointment online. Why not buy / browse glasses & contact lenses online or try our FREE hearing check?
Mobile version
https://www.specsavers.co.uk/Welcome to Specsavers Opticians | Specsavers UKFind your local Specsavers store to book an appointment online. Why not buy / browse glasses & contact lenses online or try our FREE hearing check?
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is not using social media meta tags! While this type of meta tags don't affect what people see when they visit the webpage, they exist to provide information about it to search engines and social media platforms.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
58hearing55glasses35contact33tests32lenses
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
hearing
glasses
contact
tests
lenses
Keywords Cloud Test
accountacuvueadvertisingaidsallowappointmentbakerbestbookbrandsbrowsebuyercancelchangecheckcheckboxchildrenclearcollectionscompletecontactcookiecookiescorporatedailydesignerdisposablesearwaxeasyvisioneligibilityexplainedexpressextraseyecarefacefaqsfavouritesfreefundedgendergiftglassesgreatguideguideshavehealthhearinghelphomeincludinginformationkidslabellenslenseslevimakeminecraftmyopianeedofferoffersonlineorderpairperformancepreferencesprescriptionprivacyproductreplacementrequestsafetyscansearchservicesshapesitespecsaversstoresuitsunglassestargetingtestteststodaytreatmentstrialtypeunisexvalueviewvisionvisitvisitsvoucherswebsitewomenwork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Book your appointment today
H2 tags
Why choose Specsavers Opticians and Audiologists?
Our freshest frames
Our best-loved contact lenses
Complete glasses from £15
Contact lens free trial
Top offers
2 for 1 glasses from £70
Hearing aid promise
Other ways we can help
About Cookies
Privacy Preference Center
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 67
Failed: 7
Warnings: 0
Passed: 13
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,396 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 305.28 Kb to 49.58 Kb (84% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 6.55 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
other
44.9 %
1.35 Mb
javascript
41.3 %
1.24 Mb
font
6.9 %
211.25 Kb
image
3.3 %
100.55 Kb
css
2.7 %
83.31 Kb
html
1.0 %
29.27 Kb
TOTAL
100%
3.01 Mb
Requests by content type
Content type
Percent
Requests
javascript
40.7 %
37
image
20.9 %
19
other
19.8 %
18
css
7.7 %
7
font
7.7 %
7
html
3.3 %
3
TOTAL
100%
91
Content size by domain
Domain
Percent
Size
images.specsavers.com
45.8 %
1.38 Mb
googletagmanager.com
20.3 %
626.32 Kb
specsavers.co.uk
19.8 %
610.33 Kb
cdn-ukwest.onetrust.com
5.5 %
169.38 Kb
maxcdn.bootstrapcdn.com
2.5 %
77.49 Kb
se.monetate.net
2.1 %
64.50 Kb
specsavers.egain.cloud
1.6 %
49.69 Kb
content.specsavers.com
1.0 %
29.79 Kb
analytics.analytics-egain.com
0.6 %
19.15 Kb
sb.monetate.net
0.3 %
8.91 Kb
Other
0.5 %
15.01 Kb
TOTAL
100%
3.01 Mb
Requests by domain
Domain
Percent
Requests
specsavers.co.uk
34.1 %
31
images.specsavers.com
17.6 %
16
cdn-ukwest.onetrust.com
11.0 %
10
googletagmanager.com
6.6 %
6
sb.monetate.net
5.5 %
5
sib.specsavers.com
4.4 %
4
specsavers.egain.cloud
4.4 %
4
ade.googlesyndication.com
3.3 %
3
content.specsavers.com
2.2 %
2
maxcdn.bootstrapcdn.com
2.2 %
2
Other
8.8 %
8
TOTAL
100%
91
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.272 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.272 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.141 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.141 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 6.62 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

6.62 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: By clicking “Accept All Cookies”, you agree to the storing of cookies on your de...
Html: <div id="onetrust-policy-text">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0104. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0104

0.1

0.25

DOM element which contributes the most to CLS score:
Text: 2 for 1 glasses from £70 Free contact lens trial Book your child's eye test toda...
Html: <div class="dev sib-home" data-country-code="uk">
Score: 0.0054
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 7
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.specsavers.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.specsavers.co.uk
Organization
Specsavers Optical Group Limited
Location
Guernsey, GG
Subject Alternative Names (SANs)
www.specsavers.co.uk, specsavers.co.uk
Not valid before
Tue, November 5o 2024, 12:00:00 am (z)
Not valid after
Sat, December 6o 2025, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global G2 TLS RSA SHA256 2020 CA1
Intermediate certificate
Common name
DigiCert Global G2 TLS RSA SHA256 2020 CA1
Organization
DigiCert Inc
Location
US
Not valid before
Thu, September 24o 2020, 12:00:00 am (z)
Not valid after
Mon, September 23o 2030, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root G2
Root certificate
Common name
DigiCert Global Root G2
Organization
DigiCert Inc
Location
US
Not valid before
Thu, August 1o 2013, 12:00:00 pm (z)
Not valid after
Fri, January 15o 2038, 12:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
DigiCert Global Root G2
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 50
Failed: 1
Warnings: 0
Passed: 2
Meta Viewport Test92% of top 100 sites passed
  • This webpage does not have a viewport meta tag! Add a viewport meta tag to optimize your webpage for mobile screens.
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 96
Failed: 1
Warnings: 0
Passed: 8
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.specsavers.co.uk/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.specsavers.co.uk/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:51.105.222.194 ip4:52.149.78.112 include:spftext.egain.cloud include:spf.protection.outlook.com include:spf-0023b001.pphosted.com ~all
Ads.txt Validation Test67% of top 100 sites passed
  • The access to the ads.txt file is restricted! Our request for this resource has returned a {status_code} HTTP status code. In order for this resource to be easily accessed by the DSPs and advertisers, its status code should be 200 OK.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved