seo site checkup logo
PricingFree ToolsArticles
Report generated 3 years ago
https://www.safetytechnology.org
Your general SEO Checkup Score
Archived
98/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 98 out of 100, which is higher than the average score of 75. Our analysis has identified 13 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
3 Warnings
54 Passed
Common SEO issues
Score: 67
Failed: 5
Warnings: 2
Passed: 15
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 72 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Wholesaling | Drop shipping | Self-defense | Product | Safety Technology
Length: 72 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Safety Technology has been a wholesaler and drop shipper since 1986. We sell our self-defense products through our Authorized Dealers. Want to become a dealer?
Length: 159 characters
Google Search Results Preview Test
Desktop version
https://www.safetytechnology.orgWholesaling | Drop shipping | Self-defense | Product | Safety TechnologySafety Technology has been a wholesaler and drop shipper since 1986. We sell our self-defense products through our Authorized Dealers. Want to become a dealer?
Mobile version
https://www.safetytechnology.orgWholesaling | Drop shipping | Self-defense | Product | Safety TechnologySafety Technology has been a wholesaler and drop shipper since 1986. We sell our self-defense products through our Authorized Dealers. Want to become a dealer?
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:site_name
Safety Technology | Drop ship wholesaler of self defense products and hidden cameras
og:type
article
og:title
Wholesaling | Drop shipping | Self-defense | Product | Safety Technology
og:description
Safety Technology has been a wholesaler and drop shipper since 1986. We sell our self-defense products through our Authorized Dealers. Want to become a dealer?
og:url
https://www.safetytechnology.org
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
21pepper15spray11stun9dealer8home
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
pepper
spray
stun
dealer
home
Keywords Cloud Test
actionalarmalarmsanimalapplicationauthorizedautomaticbadassbarkingbashlitebatonsbearbodybouncerbusinessbutterflycamerascaninecatalogcellcommentscontactdealerdefensedisguiseddiversiondropdummyemailfitnessflashlightsfleafoldinggardgatorguidegunshavehiddenhomejoggingkeychainskeyguardknifekniveslawslightslipstickmacemarketsmastermultiguardofficeorderpartiespepperpersonalphonepoolpricesproductspurchaserepellentrepellentsrepellerrestrictionsruntsafessafetysamplesscannerssecurityselfsellsellingshipshotshowssliderspikesprayspraysstarsstoresstuntacticaltalontechnologytelescopicthrowingtradetrainertraveltriadtriggertriplewebsitewholesalewildfireworn
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Wholesaling Self-defense Products, Hidden cameras and more. Sell at Gun shows in the United States, Flea markets, Swap meets, Trade fairs, Home Parties or E-commerce Stores
H2 tags
Would You Like To Become An Authorized Dealer?
Sell On The Internet
Sell Face To Face
Marketing materials
Digital Catalog
Visit Us
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test99% of top 100 sites passed
  • We found some HTML deprecated tags! You are advised to change these old tags with equivalent tags or proper CSS rules.
2center
Google Analytics Test69% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 88
Failed: 3
Warnings: 0
Passed: 15
HTML Page Size Test34% of top 100 sites passed
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,924 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 639.03 Kb to 98.67 Kb (85% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.28 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage has less than 20 http requests. A higher number of http requests results in a user's browser needing to request a large number of objects from the server, which will ultimately slow down the loading of your webpage.
Content size by content type
Content type
Percent
Size
font
53.0 %
390.32 Kb
html
26.7 %
196.21 Kb
other
17.9 %
131.83 Kb
image
2.4 %
17.89 Kb
css
0.0 %
0 B
javascript
0.0 %
0 B
TOTAL
100%
736.26 Kb
Requests by content type
Content type
Percent
Requests
font
60.0 %
9
html
20.0 %
3
image
13.3 %
2
other
6.7 %
1
css
0.0 %
0
javascript
0.0 %
0
TOTAL
100%
15
Content size by domain
Domain
Percent
Size
fonts.gstatic.com
40.8 %
300.39 Kb
safetytechnology.org
26.7 %
196.21 Kb
videoman.b-cdn.net
17.9 %
131.83 Kb
cdn-bpnee.nitrocdn.com
14.6 %
107.82 Kb
TOTAL
100%
736.26 Kb
Requests by domain
Domain
Percent
Requests
fonts.gstatic.com
46.7 %
7
cdn-bpnee.nitrocdn.com
26.7 %
4
safetytechnology.org
20.0 %
3
videoman.b-cdn.net
6.7 %
1
TOTAL
100%
15
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • This webpage is not using CSS resources from the same domain.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 0.56 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.56 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Wholesaling Self-defense Products, Hidden cameras and more. Sell at Gun shows in...
Html: <h1 class="elementor-heading-title elementor-size-large">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.003. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.

0.0027

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0018
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.safetytechnology.org" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sni.cloudflaressl.com
Organization
Cloudflare, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
safetytechnology.org, *.safetytechnology.org, sni.cloudflaressl.com
Not valid before
Tue, May 10o 2022, 12:00:00 am (z)
Not valid after
Wed, May 10o 2023, 11:59:59 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
Cloudflare Inc ECC CA-3
Intermediate certificate
Common name
Cloudflare Inc ECC CA-3
Organization
Cloudflare, Inc.
Location
US
Not valid before
Mon, January 27o 2020, 12:48:08 pm (z)
Not valid after
Tue, December 31o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Root certificate
Common name
Baltimore CyberTrust Root
Organization
Baltimore
Location
IE
Not valid before
Fri, May 12o 2000, 6:46:00 pm (z)
Not valid after
Mon, May 12o 2025, 11:59:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload max-age=31536000; includesubdomains; preload
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0, viewport-fit=cover" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 67
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test59% of top 100 sites passed
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.safetytechnology.org is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.safetytechnology.org" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 +a +mx +ip4:209.59.178.138 ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved