seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://www.ngstour.net
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 124 out of 100, which is higher than the average score of 75. Our analysis has identified 8 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
1 Warnings
30 Passed
Common SEO issues
Score: 81
Failed: 1
Warnings: 1
Passed: 10
Google Search Results Preview
Desktop version
http://www.ngstour.net/Informasi Umroh | Paket Umroh Murah | Paket Umroh EkonomisInformasi Umroh,Paket Umroh Ekonomis, Cara Mendaftar Umroh, Travel Umroh terbaik, Cara melaksanakan Umroh, Cara Melakukan Thawaf, Travel Umroh Bekasi, Travel Umroh Bandung, Umroh tahun baru, Biro Perjalanan Haji, Travel Umroh Resmi
Mobile version
http://www.ngstour.net/Informasi Umroh | Paket Umroh Murah | Paket Umroh EkonomisInformasi Umroh,Paket Umroh Ekonomis, Cara Mendaftar Umroh, Travel Umroh terbaik, Cara melaksanakan Umroh, Cara Melakukan Thawaf, Travel Umroh Bekasi, Travel Umroh Bandung, Umroh tahun baru, Biro Perjalanan Haji, Travel Umroh Resmi
Keywords Cloud
adalahakanallahandaasalbagaimanabagibaikbanyakbenarbenyaminberdirinyaberikutbersamabirobisacaloncaracontactdalamdapatkandaridengandepagdesemberdirihajihargaharushatiibadahindonesiainformasiizinjabaljadwaljamaahjikajugaka'bahkamikarenakeberangkatankeluargakhususkinikitakotakreterialabbaiklengkapmakkahmasjidmaupunmelaksanakanmelayanimemberikanmemenuhimemilikimemudahkanmendaftarmengertimenjelaskanmenunaikanminimalmurahniatolehpaketpendaftarpenipuanperjalananpertamareadreviewedsangatsayasebagaisediakansegeraselainsepanjangsepuluhsetiapsucisudahtahuntelahtentangterbaikterjaditidaktipstourtravelumrahumrohuntukusulyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 2 sitemaps files for your website:
Image Alt Test
  • Your webpage has 21 'img' tags and 5 of them are missing the required 'alt' attribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the asynchronous version of Google Analytics tracking code.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • We found 2 JavaScript Errors in your web page!
See results list
Speed optimizations
Score: 100
Failed: 1
Warnings: 0
Passed: 4
HTML Page Size Test
  • Congratulations! Your HTML size is 30.56 Kb and this is under the average web page size of 33 Kb.
    This leads to a faster page loading time than average.
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 123.96 Kb to 30.56 Kb (75 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 3.428 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 48
  • 3 HTML Pages
  • 2 CSS Files
  • 7 JS Files
  • 36 Images
  • 0 Flash Files
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
Server and security
Score: 53
Failed: 2
Warnings: 0
Passed: 1
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 38
Failed: 2
Warnings: 0
Passed: 3
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This means that your webpage is not the preferred one to use in the search results.
<link href="http://www.ngstour.net/" rel="canonical" />
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file is using the disallow directive but it's empty. This means that the whole website can be crawled by search engines.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved