seo site checkup logo
PricingFree ToolsArticles
Report generated 10 years ago
http://www.mypcvleuten.nl
Your general SEO Checkup Score
Archived
95/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 95 out of 100, which is higher than the average score of 75. Our analysis has identified 13 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
13 Failed
0 Warnings
27 Passed
Common SEO issues
Score: 73
Failed: 2
Warnings: 0
Passed: 10
Google Search Results Preview
Desktop version
http://mypcvleuten.nl/Computerreparatie Utrecht | Aan Huis | My PC VleutenEen laptop of computerreparatie Utrecht aan huis nodig? Computer traag of laptop sneller laten maken in regio Utrecht? voor alle reparaties bel 06-48189511
Mobile version
http://mypcvleuten.nl/Computerreparatie Utrecht | Aan Huis | My PC VleutenEen laptop of computerreparatie Utrecht aan huis nodig? Computer traag of laptop sneller laten maken in regio Utrecht? voor alle reparaties bel 06-48189511
Keywords Cloud
adviesafspraakallealleenamersfoortandereavondsbaarnbackupbedragberichtbestelbinnenbinnenkantcomputercomputerreparatiecontactcontrolecopydezedienstdienstendirectdoordriversduidelijkeemailfacebookgeholpengewoongooglegratishanterenheefthilversumhuisijsselsteininfo@mypcvleuten.nlinformatieinstallerenkomenkrijgkuntkwaliteitlaptopleverenlibersymaakmaarssenmakenmeermeernneemnieuwegeinnodigonderdelenongeveeronzeoriginelepakketplaatsenproductenregioreparatiescherpeschijfservicesnellersoestspoedstofvrijsysteemtarieftarieventhuistipstopmerkentotaaltwitterutrechtvanafvandaagverwachtenverzendenverzendingvleutenvoorvoordelenvuurschewaarborgenwebshopweekendwelkewerkenwiltwindowswoerdenwordenwordtzeist
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 1 sitemap file for your website:
Image Alt Test
  • Your webpage has 21 'img' tags and 14 of them are missing the required 'alt' attribute.
See full list
Deprecated HTML Tags
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
Google Analytics Test
  • Congratulations! Your website is using the correct version of Google Analytics tracking code.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Speed optimizations
Score: 26
Failed: 4
Warnings: 0
Passed: 1
HTML Page Size Test
HTML Compression/GZIP Test
  • Your page do not use any HTML compression!
    You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 86 % - from 190.92 Kb to 27.02 Kb which would further reduce your page loading time.
Site Loading Speed Test
  • Your site loading time is around 4.824 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 58
  • 9 HTML Pages
  • 1 CSS Files
  • 11 JS Files
  • 37 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using expires headers for your images. An expires tag can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
Server and security
Score: 53
Failed: 2
Warnings: 0
Passed: 1
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 50
Failed: 2
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage is using the canonical link tag. This means that your webpage is not the preferred one to use in the search results.
<link rel="canonical" href="http://mypcvleuten.nl">
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engins will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file does not use the disallow directive. This means that the whole website can be crawled by search engines.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 a mx ip4:185.104.29.18 ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved