seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://www.merchantloanadvance.co.uk
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 110 out of 100, which is higher than the average score of 75. Our analysis has identified 8 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
0 Warnings
64 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
Common SEO issues
Score: 95
Failed: 1
Warnings: 0
Passed: 21
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Merchant Cash Advance UK | Get £3k to £300k in 24 Hours
Length: 55 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: A Merchant Cash Advance is a fast way to borrow for your UK business. It's unsecured and you only repay through your credit/debit card sales. Apply now.
Length: 152 characters
Google Search Results Preview Test
Desktop version
https://www.merchantloanadvance.co.uk/Merchant Cash Advance UK | Get £3k to £300k in 24 HoursA Merchant Cash Advance is a fast way to borrow for your UK business. It's unsecured and you only repay through your credit/debit card sales. Apply now.
Mobile version
https://www.merchantloanadvance.co.uk/Merchant Cash Advance UK | Get £3k to £300k in 24 HoursA Merchant Cash Advance is a fast way to borrow for your UK business. It's unsecured and you only repay through your credit/debit card sales. Apply now.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_GB
og:type
website
og:title
Merchant Cash Advance UK | Get £3k to £300k in 24 Hours
og:description
A Merchant Cash Advance is a fast way to borrow for your UK business. It's unsecured and you only repay through your credit/debit card sales. Apply now.
og:url
https://www.merchantloanadvance.co.uk/
og:site_name
Merchant Cash Advance
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
54business49cash49advance37card36merchant
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
business
cash
advance
card
merchant
Keywords Cloud Test
acceptaccountadvanceapplicationapplyaveragebankbasedborrowbusinessbusinessescalculatedcardcashcomfortablecontactcostcostscreditcustomercustomersdebitdecisiondoesexamplefactorfeesfinancefinancialfixedflexiblefreefundingfuturegoodhavehelphelpedhiddenhistoryhoursinformationjustlatelenderlenderslimitedloanmachinemerchantmonthmonthlymonthsneednumberobligationofferonlineownerpaymentpaymentspercentageperformancepolicypricingprocessproductproviderprovidersqualifyquickquoteratereceiveregulatedrepaidrepayrepaymentrepaymentsretailsalesserviceshopsshortsimpleslowsmallsorodostraightforwardtermterminaltermstimestotaltraditionalturnovertypeunsecuredusingworks
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Merchant Cash Advance
H2 tags
Support your business with a Merchant Cash Advance
What are the advantages?
A perfect funding solution for any business with a PDQ terminal
What is a Merchant Cash Advance?
How does a merchant cash advance work?
How much does a merchant cash advance cost?
Frequently asked questions
What our customers say
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 86
Failed: 3
Warnings: 0
Passed: 17
HTML Page Size Test21% of top 100 sites passed
  • The size of this webpage's HTML is 13.3 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 553 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 62.08 Kb to 13.3 Kb (79% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 0.7 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
45.1 %
257.17 Kb
image
26.7 %
152.21 Kb
font
23.0 %
130.87 Kb
css
2.7 %
15.54 Kb
html
2.4 %
13.83 Kb
other
0.0 %
0 B
TOTAL
100%
569.62 Kb
Requests by content type
Content type
Percent
Requests
image
43.5 %
10
javascript
30.4 %
7
css
13.0 %
3
font
8.7 %
2
html
4.3 %
1
other
0.0 %
0
TOTAL
100%
23
Content size by domain
Domain
Percent
Size
merchantloanadvance.co.uk
68.0 %
387.37 Kb
googletagmanager.com
32.0 %
182.25 Kb
TOTAL
100%
569.62 Kb
Requests by domain
Domain
Percent
Requests
merchantloanadvance.co.uk
91.3 %
21
googletagmanager.com
8.7 %
2
TOTAL
100%
23
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.127 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.127 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.974 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.974 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.97 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.97 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Merchant Cash Advance Get £3k to £300k in 24 hours* Pay back through future ca...
Html: <header class="masthead white">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 95
Failed: 1
Warnings: 0
Passed: 6
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.merchantloanadvance.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
merchantloanadvance.co.uk
Subject Alternative Names (SANs)
merchantloanadvance.co.uk, *.merchantloanadvance.co.uk
Not valid before
Thu, September 5o 2024, 8:14:35 am (z)
Not valid after
Wed, December 4o 2024, 9:14:32 am (z)
Signature algorithm
ecdsaWithSha256
Issuer
WE1
Intermediate certificate
Common name
WE1
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Root certificate
Common name
GTS Root R4
Organization
Google Trust Services LLC
Location
US
Not valid before
Wed, June 22o 2016, 12:00:00 am (z)
Not valid after
Sun, June 22o 2036, 12:00:00 am (z)
Signature algorithm
ecdsaWithSha384
Issuer
GTS Root R4
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=15552000; preload
Plaintext Emails Test100% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 65
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.merchantloanadvance.co.uk/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.merchantloanadvance.co.uk/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 a mx include:sendgrid.net include:servers.mcsv.net include:_spf.google.com include:spf.zoho.eu include:eu.transmail.net -all
Ads.txt Validation Test68% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=utf-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved