seo site checkup logo
PricingFree ToolsArticles
Report generated 4 years ago
https://www.electriciansrochestermn.com
Your general SEO Checkup Score
Archived
86/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 86 out of 100, which is higher than the average score of 74. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
1 Warnings
43 Passed
Common SEO issues
Score: 91
Failed: 2
Warnings: 1
Passed: 18
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Electrician Rochester MN | Best Rochester Electrician
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Get help from the #1 and most trusted electricians in the region. Talk to us today. Tell us about your electrical issues.
Google Search Results Preview Test
Desktop version
https://www.electriciansrochestermn.comElectrician Rochester MN | Best Rochester ElectricianGet help from the #1 and most trusted electricians in the region. Talk to us today. Tell us about your electrical issues.
Mobile version
https://www.electriciansrochestermn.comElectrician Rochester MN | Best Rochester ElectricianGet help from the #1 and most trusted electricians in the region. Talk to us today. Tell us about your electrical issues.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
24rochester19electrical12electrician11service10business
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
administeredadvertisingaffordableareasassistbestbusinessbusinessescareceilingcircuitclasscommercialcompanycomputerscontractorcontractorscustomerelectricalelectricianelectricianselectricityenergyensureequipmentespeciallyexperienceexpertfreefriendlyguaranteehandlehappilyhelphighlyhomehomeshonestincludeindustrialinstallationinsuredissueissuesknowlicensedlightinglightslikelookmaintenancemoneyneedneedsoutletphoneproblemsprofessionalproficientprovideprovidesprovidingpurposesrangeratesreadyregionreliablerepairrepairsresidentialrightrochestersafetysatisfactionsaveserveserviceservicessimplyskilledsolutionsolutionssolvestaffstandsystemstaskteamtechniciantechnicianstimetimelytrusttrustedunderstandupgradewebsiteworkworkmanship
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
electrician Rochester mn
THE MOST TRUSTED
ROCHESTER, MN ELECTRICIANS
H2 tags
We know that finding a proficient and reliable electrician in Rochester, MN can be a time consuming and tiresome task, especially if you are new to the area or have never worked with a local service company before. That is why we promise to bring you only the best in electrical service repair and installation. We stand by our work 100%. Since we first opened our doors, we have taken our business very seriously and have strived to provide exceptional work on a daily basis. Our staff of highly qualified contractors have years of experience under their belts, and our business continues to grow in all areas of residential, commercial, and industrial services. Each member of our team is a licensed and insured technician, and we proudly maintain a highly positive customer satisfaction rating.
We always put your needs first. Whether it is for a new installation of electrical equipment or repair of any part of your existing electrical system, our master Rochester, MN electricians will provide you with unparalleled service. We are honest, proficient, and understanding, and provide customer-oriented solutions.  We understand that emergencies happen, and some electrical problems cannot wait. Because of this, we do everything we can to schedule you for an appointment on the same business day, especially if you call us early in the morning. We also understand that electrical problems are never convenient and often occur outside of normal business hours of operation. That is why we happily provide you with 24/7 customer service. Simply give us a call and we will send a technician to your home or business as soon as possible.
Whether your electrical needs are for safety and security or specialty lighting during the holiday season, our highly skilled electrician in Rochester, MN can help you. We get the job done right the first time. With 24/7 availability and prompt service, our team offers a full range of solutions that can benefit your home, business, and even the environment. We provide everything from electrical repairs, upgrades, and installations to custom lighting designs, energy audits, and environmentally friendly solar and energy solutions. Our first class workmanship is second to none, and you will find our prices to be pleasantly affordable. Our team of licensed and professional contractors is ready to assist you and solve your electrical problem so that you can get back to living your best life with peace of mind.
​
We provide free and reliable estimates over the phone and may include an onsite visit, depending on the scope of work. Our team of Rochester, MN electricians provides a full-range of solutions for residential, commercial and industrial maintenance in a way that is sustainable, reliable and dependable. We have state of the art equipment that enables us to provide timely service with skill and precision.  We enjoy a phenomenal reputation in the industry for quality, safety and service.  We value your time and are always punctual, respectful, and honest. Our technicians are highly skilled professionals who care deeply about their work.  We stand by our work 100% and guarantee your satisfaction. We aim to continue growing our business by providing outstanding customer service and workmanship, and developing repeat business with our valued customers.
We provide solutions in multiple areas, including (but not limited to) the following:
We serve Rochester and our surrounding communities.
Electrician Rochester MN
Robots.txt Test
  • This website is using a robots.txt file.
https://www.electriciansrochestermn.com/robots.txt
Sitemap Test
  • Congratulations! Your website has a sitemap file.
https://www.electriciansrochestermn.com/sitemap.xml
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage is using "img" tags with empty or missing "alt" attribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Test
  • Congratulations! Your website is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 91
Failed: 2
Warnings: 0
Passed: 14
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 585.8 Kb to 78.81 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 1.59 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Total Objects: 27
  • 1 HTML Pages
  • 0 CSS Files
  • 15 JS Files
  • 11 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Image Caching Test
  • Your webpage is not using uncached images from your domain.
JavaScript Caching Test
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test
  • Your webpage is not using uncached CSS resources from your domain.
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Your webpage is not using CSS resources from the same domain.
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 86
Failed: 1
Warnings: 0
Passed: 5
URL Canonicalization Test
HTTPS Test
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
Server: Pepyaka/1.15.10
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 33
Failed: 3
Warnings: 0
Passed: 5
Structured Data Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Custom 404 Error Page Test
  • Your website is not using a custom 404 error page. Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave your site entirely, and looks unprofessional. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.electriciansrochestermn.com is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.electriciansrochestermn.com" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.

Check your website's SEO
Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2020-2024 • All rights reserved