seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://www.dwidayatour.co.id
Your general SEO Checkup Score
Archived
65/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 65 out of 100, which is below the average score of 75. However, there are 25 SEO issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
25 Failed
3 Warnings
43 Passed
Issues to fix
HIGH
To provide a good user experience, Google recommends that sites should aim for a Largest Contentful Paint duration of 2.5 seconds or less.
HIGH
To provide a good user experience, Google recommends that sites should aim for a Cumulative Layout Shift score of 0.1 or less.
HIGH
To address URL canonicalization issues, it is recommended to select a primary URL for your webpage and set up redirects from all other variations to the preferred one.
HIGH
Minify all JavaScript files to reduce page size and loading time.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Consider using structured data in your webpage as it can help search engines gain a better understanding of your content.
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Add a sitemap file to help search engine crawlers index content more thoroughly and quickly.
MEDIUM
Add a robots.txt file to properly communicate with web crawlers and prevent unwanted access to sensitive content.
MEDIUM
To provide a good user experience, Google recommends that sites should aim for a First Contentful Paint value of 1.8 seconds or less.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
LOW
This website either lacks a favicon or it has not been referenced properly.
Common SEO issues
Score: 49
Failed: 7
Warnings: 2
Passed: 13
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 17 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Dwidaya Worldwide
Length: 17 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Berpengalaman lebih dari 55 tahun, Liburan hemat terjamin akan selalu nyaman dengan berbagai promo tiket pesawat, paket tour hemat, dan hotel ke seluruh dunia
Length: 158 characters
Google Search Results Preview Test
Desktop version
https://www.dwidayatour.co.id/Dwidaya WorldwideBerpengalaman lebih dari 55 tahun, Liburan hemat terjamin akan selalu nyaman dengan berbagai promo tiket pesawat, paket tour hemat, dan hotel ke seluruh dunia
Mobile version
https://www.dwidayatour.co.id/Dwidaya WorldwideBerpengalaman lebih dari 55 tahun, Liburan hemat terjamin akan selalu nyaman dengan berbagai promo tiket pesawat, paket tour hemat, dan hotel ke seluruh dunia
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Dwidaya Worldwide
og:description
Berpengalaman lebih dari 55 tahun, Liburan hemat terjamin akan selalu nyaman dengan berbagai promo tiket pesawat, paket tour hemat, dan hotel ke seluruh dunia
og:locale
id-ID
og:url
https://www.dwidayatour.co.id/?lang=
og:image
https://tcscrm.dwidayatour.co.id/Images/DWW/SM/1-sm-id-seobanner.jpg
og:image:alt
Dwidaya
og:image:width
1858
og:image:height
602
og:image:type
image/jpeg
og:site_name
PT Dwidaya World Wide
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
150airlines62airways43beli38dari27aviation
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
airlines
airways
beli
dari
aviation
Keywords Cloud Test
aeroaerolineasafricaairasiaairlineairlinesairwaysajakakanalaskaanakandaarabiaasiaatauatlanticaustralaustraliaaviationazulbalibangkokbelibluecargocarichinacookiecruisedaftardaridengandubaidwidayaeasternemailexpressfebruaryhotelhotelsindiaindonesiaindonesianintlislandjakartajalanjanuaryjapanjetstarkamikatakeindahankomodokonglihatlinelinhasmasukmenerimamengunjunginationalnorthnorwegianpacificpaketpenerbanganpenumpangpergiperupesananphuketpulangregionalroyalsafarisandisekalisekarangservicesingaporesouthernstatestamantemukanterbaikthaitourtranstraveltujuanuniteduntukvirginwaktuwestwidewingsworldyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Tujuan penerbangan teratas
Hotel unggulan
Paket wisata populer
Jelajahi produk kami yang lain
Tujuan populer
Temukan blog kami
Temukan yang terbaik
manfaat eksklusif!
ikuti kami
Robots.txt Test99% of top 100 sites passed
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test74% of top 100 sites passed
  • This website lacks a sitemap file! Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • This website either doesn't have a favicon or this has not been referenced correctly!
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 39
Failed: 11
Warnings: 1
Passed: 8
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 5,276 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 953.41 Kb to 61.7 Kb (94% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 13.22 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
88.8 %
33.96 Mb
javascript
8.2 %
3.14 Mb
html
1.5 %
571.88 Kb
css
0.8 %
312.85 Kb
font
0.8 %
300.98 Kb
other
0.0 %
1.13 Kb
TOTAL
100%
38.26 Mb
Requests by content type
Content type
Percent
Requests
image
48.8 %
62
javascript
29.1 %
37
css
9.4 %
12
html
5.5 %
7
other
3.9 %
5
font
3.1 %
4
TOTAL
100%
127
Content size by domain
Domain
Percent
Size
tcscrm.dwidayatour.co.id
88.2 %
33.76 Mb
dwidayatour.co.id
11.3 %
4.33 Mb
googletagmanager.com
0.4 %
150.89 Kb
google-analytics.com
0.1 %
20.82 Kb
cdnjs.cloudflare.com
0.0 %
1.23 Kb
extreme-ip-lookup.com
0.0 %
612 B
google.com
0.0 %
408 B
stats.g.doubleclick.net
0.0 %
319 B
analytics.google.com
0.0 %
210 B
TOTAL
100%
38.26 Mb
Requests by domain
Domain
Percent
Requests
dwidayatour.co.id
52.0 %
66
tcscrm.dwidayatour.co.id
40.2 %
51
googletagmanager.com
1.6 %
2
google-analytics.com
1.6 %
2
stats.g.doubleclick.net
1.6 %
2
cdnjs.cloudflare.com
0.8 %
1
extreme-ip-lookup.com
0.8 %
1
analytics.google.com
0.8 %
1
google.com
0.8 %
1
TOTAL
100%
127
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • This webpage is using JavaScript files that are not minified!
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.673 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.673 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 3.872 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

3.872 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 5.01 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

5.01 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="https://tcscrm.dwidayatour.co.id/images/DWW/Promo/..." alt="Temukan Paket Tur, Tiket, dan Hotel Terlengkap di ...">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 1.1290. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

1.129

0.1

0.25

DOM element which contributes the most to CLS score:
Text: PREVIOUS NEXT Penerbangan Hotel Tur Sekali Jalan Pulang-Pergi Multi-kota Ber...
Html: <div id="main">
Score: 1.0000
Server and security
Score: 64
Failed: 3
Warnings: 0
Passed: 4
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.dwidayatour.co.id" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.dwidayatour.co.id
Subject Alternative Names (SANs)
*.dwidayatour.co.id, dwidayatour.co.id
Not valid before
Tue, September 26o 2023, 12:00:00 am (z)
Not valid after
Fri, October 25o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Sectigo RSA Domain Validation Secure Server CA
Intermediate certificate
Common name
Sectigo RSA Domain Validation Secure Server CA
Organization
Sectigo Limited
Location
Salford, Greater Manchester, GB
Not valid before
Fri, November 2o 2018, 12:00:00 am (z)
Not valid after
Tue, December 31o 2030, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains
Plaintext Emails Test100% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 60
Failed: 2
Warnings: 0
Passed: 6
Structured Data Test53% of top 100 sites passed
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage does not use the canonical link tag.
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • This website lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved