seo site checkup logo
PricingFree ToolsArticles
Report generated 2 months ago
https://www.drupendrarathore.com
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 106 out of 100, which is higher than the average score of 75. Our analysis has identified 11 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
2 Warnings
59 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serving resources (images, JS, CSS) from a CDN service, could improve website loading times, reduce bandwidth costs and increase content availability and redundancy.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Add a Google Analytics script to this website to help in diagnosing potential SEO issues by monitoring site visitors and traffic sources.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Without an SPF record, spammers can easily spoof emails from this domain, potentially leading to compromised email security and deliverability issues.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
Common SEO issues
Score: 89
Failed: 2
Warnings: 1
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Dr. Upendra Rathore | Best Rheumatologist in Indore
Length: 51 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Dr. Upendra Rathore, a board-certified Rheumatologist in Indore, offers expert care for arthritis, autoimmune diseases, and joint pain at the Arthritis & Rheumatology Clinic.
Length: 174 characters
Google Search Results Preview Test
Desktop version
https://www.drupendrarathore.com/Dr. Upendra Rathore | Best Rheumatologist in IndoreDr. Upendra Rathore, a board-certified Rheumatologist in Indore, offers expert care for arthritis, autoimmune diseases, and joint pain at the Arthritis & Rheumatology Clinic.
Mobile version
https://www.drupendrarathore.com/Dr. Upendra Rathore | Best Rheumatologist in IndoreDr. Upendra Rathore, a board-certified Rheumatologist in Indore, offers expert care for arthritis, autoimmune diseases, and joint pain at the Arthritis & Rheumatology Clinic.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Dr. Upendra Rathore | Best Rheumatologist in Indore
og:description
Looking for the best rheumatologist in Indore? Consult Dr. Upendra Rathore, leading Rheumatologist in Indore at Arthritis & Rheumatology Clinic. Expert in arthritis, autoimmune diseases, osteoporosis, and joint pain management.
og:url
https://www.drupendrarathore.com
og:site_name
Dr. Upendra Rathore | Arthritis & Rheumatology Clinic
og:locale
en_IN
og:image
https://www.drupendrarathore.com/images/ogimage/dr-upendra-rathore-OG-Image.png
og:image:width
1200
og:image:height
630
og:image:alt
Dr. Upendra Rathore, Rheumatologist in Indore
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
12arthritis9appointment9pain8rheumatologist8contact
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
arthritis
appointment
pain
rheumatologist
contact
Keywords Cloud Test
appointmentappointmentsarthritisasianautoimmunebachelorbestbetterblogsboardbookbookedbookingcarecertifiedchronicclinicclinicalcomfortcomplexcomprehensiveconditionsconsultationcontactdegreediagnosingdiagnosisdiseasesdoctordrupendrarathoreeasyeffectiveemailexperienceexpertexpertiseexplorefamilyfeelfreegalleryhappyhavehealthhealthcarehelphelpfulhomeimmunologicalindoreinjectionsinternalissuesjointjustkneelearnlinkslookingmanagementmbbsmedicalmedicinemodernmythsneedpainpatientpatientspersonalizedpostgraduatepriorityquestionsquickrathorereadreadsreviewsrheumatologistrheumatologysafeseniorserviceservicesspecializedstresssupportswellingteamthinktodaytrainingtreatingtreatmenttrustedupcomingupendravisitwomenyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
Best Rheumatologist in Indore
H2 tags
We Care Like Family
Our Services
Our Clinic
Why Choose Us
Book Appointment
Personal Info
Dr. Upendra Rathore
Latest Blogs
Contact Us
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
Image Alt Test78% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test27% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Speed optimizations
Score: 81
Failed: 4
Warnings: 0
Passed: 16
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 675 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 164.87 Kb to 35.49 Kb (78% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 1.58 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
44.1 %
304.43 Kb
javascript
40.2 %
277.66 Kb
font
4.5 %
31.40 Kb
html
4.0 %
27.83 Kb
other
3.9 %
26.96 Kb
css
3.3 %
22.73 Kb
TOTAL
100%
691.01 Kb
Requests by content type
Content type
Percent
Requests
javascript
33.3 %
20
css
28.3 %
17
image
18.3 %
11
other
11.7 %
7
font
6.7 %
4
html
1.7 %
1
TOTAL
100%
60
Content size by domain
Domain
Percent
Size
drupendrarathore.com
100.0 %
691.01 Kb
TOTAL
100%
691.01 Kb
Requests by domain
Domain
Percent
Requests
drupendrarathore.com
100.0 %
60
TOTAL
100%
60
CDN Usage Test95% of top 100 sites passed
  • This webpage is not serving resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.026 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.026 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.860 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.86 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.86 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.86 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
Text: Dr. Upendra Rathore
Html:
Dr. Upendra Rathore
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0003. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0003

0.1

0.25

DOM element which contributes the most to CLS score:
Html:
Score: 0.0001
Server and security
Score: 86
Failed: 2
Warnings: 0
Passed: 5
URL Canonicalization Test93% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.drupendrarathore.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.drupendrarathore.com
Subject Alternative Names (SANs)
www.drupendrarathore.com
Not valid before
Sat, August 23o 2025, 1:44:34 pm (z)
Not valid after
Fri, November 21o 2025, 1:44:33 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
R12
Intermediate certificate
Common name
R12
Organization
Let's Encrypt
Location
US
Not valid before
Wed, March 13o 2024, 12:00:00 am (z)
Not valid after
Fri, March 12o 2027, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Root certificate
Common name
ISRG Root X1
Organization
Internet Security Research Group
Location
US
Not valid before
Thu, June 4o 2015, 11:04:38 am (z)
Not valid after
Mon, June 4o 2035, 11:04:38 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
ISRG Root X1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=63072000
Plaintext Emails Test97% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 90
Failed: 2
Warnings: 1
Passed: 6
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.drupendrarathore.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.drupendrarathore.com" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is not using an SPF record! SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Ads.txt Validation Test67% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
See results list

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved