seo site checkup logo
PricingFree ToolsArticles
Report generated 14 hours ago
https://www.cryptofundadvisor.online/2025/11/best-small-cap-mutual-funds-in-india.html
Your general SEO Checkup Score
Archived
81/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 81 out of 100, which is higher than the average score of 75. Our analysis has identified 10 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
3 Warnings
48 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Consider reducing the HTML size to improve loading times and retain visitors.
LOW
Use only one canonical link tag per webpage, as multiple tags will cause search engines to ignore all of them, potentially leading to duplicate content issues.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider adding the Strict-Transport-Security header to your webpage to ensure that web traffic is encrypted over HTTPS, mitigating the risk of man-in-the-middle attacks and other security threats.
Common SEO issues
Score: 79
Failed: 2
Warnings: 3
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Best Small Cap Mutual Funds in India 2026.
Length: 42 characters
Meta Description Test92% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Discover the best small cap mutual funds in India for 2025. Compare returns, risk, fund performance, and expert insights to choose top small cap fund.
Length: 150 characters
Google Search Results Preview Test
Desktop version
https://www.cryptofundadvisor.online/2025/11/best-small-cap-mutual-funds-in-india.htmlBest Small Cap Mutual Funds in India 2026.Discover the best small cap mutual funds in India for 2025. Compare returns, risk, fund performance, and expert insights to choose top small cap fund.
Mobile version
https://www.cryptofundadvisor.online/2025/11/best-small-cap-mutual-funds-in-india.htmlBest Small Cap Mutual Funds in India 2026.Discover the best small cap mutual funds in India for 2025. Compare returns, risk, fund performance, and expert insights to choose top small cap fund.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
article
og:title
Best Small Cap Mutual Funds in India 2026.
og:url
https://www.cryptofundadvisor.online/2025/11/best-small-cap-mutual-funds-in-india.html
og:description
Discover the best small cap mutual funds in India for 2025. Compare returns, risk, fund performance, and expert insights to choose top small cap fund.
og:site_name
Smart Investing with Crypto & SIPs
og:image
https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEg1jIqBhUeQEhA_t531DsSafV7p8hBI2L6vwLkxfa65k4HLGraiO1JT7kE2Qap3C2KS8DYaHG7v2ZtorfeHwmwA0d1BoUii4CXhaaeVpnqKHuns1JtsBJBCj2Tsqv5unzqcg9aIAUFBkQNM7KDM4go4bqg6E_6Fd_bNVKh9EocqNGKH5rIqCEZnNO7qVUSy/s320/images%20(2).jpeg
og:locale
en
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
40funds38small25mutual23fund16bitcoin
Keywords Usage Test48% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
funds
small
mutual
fund
bitcoin
Keywords Cloud Test
aniketaprilaveragebeginnersbenefitsbestbetterbitcoinbusinessescapscoinbasecompaniescompletecompoundingcomprehensiveconditionsconsidercontactcryptocryptocurrencydecemberdeliverdigitaldisciplineddisclaimersdiversificationearlyethereumexchangefacebookfaqsfastfundfundsfutureghunguregoldgrowinggrowthguidehavehighhigherhistoryhomehorizonindiainsightsinvestinvestinginvestmentinvestorsjanuaryjulylargeleadinglongmanagementmarketmarketsmegamenumonthmutualnovemberofferingperformanceplatformspolicypopularpotentialpredictionpriceprivacyprofitreadreturnsreviewriskriskssafestscalpingseptembersharesipssmallstartstepstrategiesstrongsubjecttargetstechnologytermtermstradingvolatilevolatilityworksyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test62% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Best Small Cap Mutual Funds in India 2026.
🏆 Best Small Cap Mutual Funds in India 2025: Growth, Risks & Returns Explained
H2 tags
🌱 What Are Small Cap Funds?
Best Small Cap Mutual Funds in India 2026.
5 Best and Safest Bitcoin Trading Platforms for Beginners in 2025 - 2026
Beginner’s Guide to ETFs and Index Funds: How to Start Investing Wisely
Mutual Funds for Beginners: How to Start Investing in 2025
Bitcoin and Ethereum Price Targets for 2025–2030 (With Market Insights)
Coinbase Review 2025: A Leading Cryptocurrency Exchange for Trading Bitcoin, Ethereum & More
What Is Digital Gold? The Complete Guide to Bitcoin’s History, Benefits, and Future
What is SIP in Mutual Fund? How It Works, Benefits, and Step-by-Step Guide
Bitcoin Scalping Strategies: How to Profit Fast in a Volatile Market
What is mutual fund?
SOL Coin Price Prediction, Technical Analysis & News
Traditional vs Digital: Mutual Funds or Crypto in 2025 - 2026 ?
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test83% of top 100 sites passed
  • This website has a sitemap file.
Image Alt Test78% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test29% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test72% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test83% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test27% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test96% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Speed optimizations
Score: 80
Failed: 4
Warnings: 0
Passed: 16
HTML Page Size Test23% of top 100 sites passed
DOM Size Test56% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 871 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test99% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 233.25 Kb to 53.02 Kb (77% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test71% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.79 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test53% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
44.3 %
957.93 Kb
image
31.0 %
670.40 Kb
font
13.1 %
283.41 Kb
other
5.6 %
121.33 Kb
html
5.5 %
118.20 Kb
css
0.6 %
13.01 Kb
TOTAL
100%
2.11 Mb
Requests by content type
Content type
Percent
Requests
image
47.4 %
27
javascript
17.5 %
10
html
14.0 %
8
css
8.8 %
5
font
7.0 %
4
other
5.3 %
3
TOTAL
100%
57
Content size by domain
Domain
Percent
Size
blogger.googleusercontent.com
30.8 %
665.72 Kb
blogger.com
20.2 %
437.58 Kb
pagead2.googlesyndication.com
16.2 %
350.35 Kb
fonts.gstatic.com
13.1 %
283.41 Kb
googletagmanager.com
6.6 %
142.07 Kb
cdnjs.cloudflare.com
6.5 %
140.19 Kb
cryptofundadvisor.online
5.0 %
107.41 Kb
ep1.adtrafficquality.google
0.6 %
13.44 Kb
ep2.adtrafficquality.google
0.6 %
12.52 Kb
4.bp.blogspot.com
0.2 %
4.60 Kb
Other
0.3 %
6.98 Kb
TOTAL
100%
2.11 Mb
Requests by domain
Domain
Percent
Requests
blogger.googleusercontent.com
42.1 %
24
pagead2.googlesyndication.com
10.5 %
6
blogger.com
8.8 %
5
cryptofundadvisor.online
7.0 %
4
fonts.gstatic.com
7.0 %
4
cdnjs.cloudflare.com
5.3 %
3
ep2.adtrafficquality.google
5.3 %
3
googleads.g.doubleclick.net
3.5 %
2
ep1.adtrafficquality.google
3.5 %
2
fonts.googleapis.com
1.8 %
1
Other
5.3 %
3
TOTAL
100%
57
CDN Usage Test95% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test43% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test95% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test96% of top 100 sites passed
  • This webpage is not using uncached JavaScript resources from same domain!
CSS Caching Test98% of top 100 sites passed
  • This webpage is not using uncached CSS resources from same domain!
JavaScript Minification Test98% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test15% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
URL Redirects Test97% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test99% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.357 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.357 s

0.8 s

1.8 s

First Contentful Paint Test90% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 1.580 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

1.58 s

1.8 s

3 s

Largest Contentful Paint Test77% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.48 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.48 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img border="0" data-original-height="702" data-original-width="1024" height="438" loading="lazy" src="https://blogger.googleusercontent.com/img/b/R29vZ2..." width="640">
Cumulative Layout Shift Test91% of top 100 sites passed
  • The CLS score of this webpage is 0.0972. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0972

0.1

0.25

DOM element which contributes the most to CLS score:
Text:  Nippon India Small Cap Fund  Quant Small Cap Fund  Bandhan Small Cap Fund  Tata...
Html: <ol style="text-align: left;">
Score: 0.0767
Server and security
Score: 84
Failed: 2
Warnings: 0
Passed: 5
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.cryptofundadvisor.online" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.cryptofundadvisor.online
Subject Alternative Names (SANs)
www.cryptofundadvisor.online
Not valid before
Fri, October 24o 2025, 2:52:39 pm (z)
Not valid after
Thu, January 22o 2026, 3:39:47 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
WR3
Root certificate
Common name
WR3
Organization
Google Trust Services
Location
US
Not valid before
Wed, December 13o 2023, 9:00:00 am (z)
Not valid after
Tue, February 20o 2029, 2:00:00 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GTS Root R1
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test99% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test84% of top 100 sites passed
  • This webpage is not using the Strict-Transport-Security header! This is a security header that was created as a way to force the browser to use secure connections when a site is running over HTTPS.
Plaintext Emails Test97% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test92% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 86
Failed: 2
Warnings: 0
Passed: 7
Structured Data Test66% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test80% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • We've found multiple canonical link tags. When more than one is specified, all canonical tags will be ignored!
<link href="https://www.cryptofundadvisor.online/" rel="canonical"/>
<link href="https://www.cryptofundadvisor.online/2025/11/best-small-cap-mutual-funds-in-india.html" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test98% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:spf.titan.email ~all
Ads.txt Validation Test67% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved