seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
https://www.butaairways.az/az
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 123 out of 100, which is higher than the average score of 75. Our analysis has identified 8 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
1 Warnings
32 Passed
Common SEO issues
Score: 76
Failed: 2
Warnings: 1
Passed: 9
Google Search Results Preview
Desktop version
https://www.butaairways.az/azButa Airways – Onlayn bronlaşdırmaButa Airways aşağıbüdcəli aviaşirkətinin biletlərini ən sərfəli qiymətə rəsmi saytda onlayn əldə edin!
Mobile version
https://www.butaairways.az/azButa Airways – Onlayn bronlaşdırmaButa Airways aşağıbüdcəli aviaşirkətinin biletlərini ən sərfəli qiymətə rəsmi saytda onlayn əldə edin!
Keywords Cloud
adalarıfransafransaadalarıkapeadalarıkolumbiyakomoradalarıkonqoadalarıkurasaoküveytqabonqambiyaqanaqatarqazaxıstanqərbiadalarımalimaltamarşaladalarımartinikmavrikimavritaniyamayotmeksikamenadalarıpolşaportuqalpuertoadalarısomalisudansurinamsuriyasvalbardadalarıtuvalutürkiyatürkmənistanukraynauqandauolisadalarıŞriadasımisirmoldovamonakomonqoliyamonseratmonteneqromozambikmüqəddəsadasımərakeşmərkəziadasınorveçomanÖzbəkistanpakistanpalaupanamapapuaadasızambiyazimbabveafrikaairways”antalyaaxtarazərbaycanbakıbartolomeysanbizimləbrazzavilkonqobutacənubdişifutunauruqvayvanuatuvatikanvenesuelavyetnamyamaykayaponiyayenigürcüstangəncəhaqqındaheydərjulyanikaikoskaledoniyayenikazankinşasakosovokostakiyevkonqkoreyaŞimalikunyatunisturkslankatacikistantanzaniyataylandtayvantokelautoqotonqatrinidadleonsinqapursintlüsiyasanmaartenslovakiyasloveniyasolomonmarianamarinosanmartinsanmayensvazilendŞərqimineralnıyemoskvanevissanniderlandıkaymannöqtəsipolineziyasıgernseygibraltargürcüstanhaitihindistanhondurashonqprioritetqidalanmaqvineyaparaqvayperupitkernqviyanasıfransızrespublikasımikroneziyamiladrikakubakukrikoreunionruandarumıniyarusiyasalvadorsamoasanrusiyas.gökcənsaharaqırğızıstanqrenadaqrenlandiyaquamqvadelupaqvatemalaqvineyaqvineyabisauqviyanalaoslatviyalesotoliberiyalixtenşteynlitvalivanliviyalüksemburqmacarıstanmadaqaskarmakaosahilifilippinfinlandiyafolklendsanktpeterburqsayıtbilisitehrantimorŞimalitobaqotristantürkiyəukraynauçuşuşaqlarınverdekaribvircinvnukovovodıxomeynixüsusiyaşıyelenamyanmanamibiyanaurunepalniderlandnigernigeriyanikaraquaniuenorfolkyeniyerlərzelandiyayəmənyunanıstanyüksəlişÇinmakedoniyamalavimalayziyamaldivÇinxorvatiyaİndoneziyaİordaniyaİraqİranİrlandiyaİslandiyaİspaniyaİsrailİsveçİsveçrəİtaliyakambocakamerunkanadakanarüçünİmamİnzibatiİranİstanbulƏliyevƏraziƏrazilərifransızƏtraflıəlaqə“buta
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Image Alt Test
  • Your webpage has 8 'img' tags and 2 of them are missing the required 'alt' attribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Speed optimizations
Score: 76
Failed: 2
Warnings: 0
Passed: 4
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 95.94 Kb to 11.67 Kb (88 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 8.158 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 55
  • 1 HTML Pages
  • 12 CSS Files
  • 21 JS Files
  • 21 Images
  • 0 Flash Files
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
URL Redirects Checker
  • Congratulations! Your URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 80
Failed: 1
Warnings: 0
Passed: 2
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We found 1 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page is using the canonical link tag. This tag specifies that the URL: https://www.butaairways.az/az is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link rel="canonical" href="https://www.butaairways.az/az/">
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record. This SPF record is listed below:
v=spf1 +a +mx +ip4:109.127.1.29 +ip4:85.132.70.218 +ip4:85.132.43.0/24 +ip4:213.172.74.101 +ip4:109.235.198.41 ~all
Check your website's SEO
Analyze and monitor your SEO with our powerful SEO ToolBox
Try the new features of our supercharged SEO ToolBox using a 7-day free trial account
seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
Company
Legal
© SEO Site Checkup 2020-2025 • All rights reserved