seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://uclan.ac.uk
Your general SEO Checkup Score
Archived
86/100
SEO Score
Average SEO score of top 100 sites: 75%
This website received an SEO score of 86 out of 100, which is higher than the average score of 75. Our analysis has identified 8 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
8 Failed
5 Warnings
61 Passed
Issues to fix
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 80
Failed: 4
Warnings: 2
Passed: 20
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: University of Central Lancashire - UCLan
Length: 40 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Founded in 1828, UCLan is a leading modern university recognised in QS World Rankings. Study at campuses in Preston, Burnley, Cumbria & Cyprus. Apply now.
Length: 154 characters
Google Search Results Preview Test
Desktop version
https://www.uclan.ac.uk/University of Central Lancashire - UCLanFounded in 1828, UCLan is a leading modern university recognised in QS World Rankings. Study at campuses in Preston, Burnley, Cumbria & Cyprus. Apply now.
Mobile version
https://www.uclan.ac.uk/University of Central Lancashire - UCLanFounded in 1828, UCLan is a leading modern university recognised in QS World Rankings. Study at campuses in Preston, Burnley, Cumbria & Cyprus. Apply now.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
University of Central Lancashire
og:title
University of Central Lancashire
og:description
Founded in 1828, UCLan is a leading modern university recognised in QS World Rankings. Study at campuses in Preston, Burnley, Cumbria & Cyprus. Apply now.
og:url
https://www.uclan.ac.uk/
og:image
https://www.uclan.ac.uk/image-library/content/students/students-spine-walk.x8ff09979.jpg?f=webp&q=75&w=1200&h=630
og:type
website
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
27open26cookies18university14menu12opens
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
open
cookies
university
menu
opens
Keywords Cloud Test
academicacceptadvertisingallowapplyapprenticeshipsbookbrowserbusinesscampuscampusescentralchatcheckboxchooseclearingcloseconsentcontactcookiecookiescostcountrycoursesdaysdegreedetailsdevelopmentdevicedirectlyenterpriseexperienceexplorefacilitiesfeesfridayhaveimpactinformationinternationalitemjobsjoinjuneknowknowledgelabellancashirelifelivinglogomainmenunavigationnecessarynewsnovemberoctoberopenopensorderpartnersperformancepostgraduatepreferencesprestonprivacyprofessionalprospectusresearchsavedsearchservicessettingsshortsitestaffstartstorestudentstudentsstudysubjectssuccesssupporttargetingthursdaytimestourtutortypesuclanundergraduateuniversityusageusedvisitwebsitewednesdaywork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Where opportunity creates success
H2 tags
Cookies
Privacy Preference Centre
Your saved courses
Ignite your potential
Undergraduate Open Days
Chat to a tutor
UCLan ranked most affordable university in the country
Find a course
Legal eagle is heading to the Bar
Paramedic students put to the test in explosive emergency scenarios
Discover the Degree Show 2024
University of Central Lancashire rises to top 15 percent in Times Higher Education University Impact Rankings
Ukrainian refugees express resilience through art
Explore our campuses
Brush up on dental knowledge at free talk
Vice-Chancellor urges Prime Minister to retain Graduate Visa Route
Start university this September
Free family-friendly festival returns to Preston
Morgan Sindall hands over first phase of University’s Vet School
Cost of living at university
University recognises child research experts
Brave mum wins prestigious Martin Kenney financial investigation award
Join us on campus
At the helm of the North West's waterways
A festival of music and culture for Preston and the surrounding areas
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 81
Failed: 3
Warnings: 3
Passed: 19
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,129 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 300.0 Kb to 50.05 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.01 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
69.6 %
1.79 Mb
javascript
25.6 %
674.14 Kb
font
2.0 %
51.80 Kb
html
1.7 %
44.83 Kb
other
0.9 %
24.10 Kb
css
0.2 %
6.12 Kb
TOTAL
100%
2.58 Mb
Requests by content type
Content type
Percent
Requests
image
53.4 %
31
javascript
24.1 %
14
other
10.3 %
6
font
6.9 %
4
css
3.4 %
2
html
1.7 %
1
TOTAL
100%
58
Content size by domain
Domain
Percent
Size
uclan.ac.uk
83.2 %
2.14 Mb
cdn.cookielaw.org
8.5 %
225.08 Kb
googletagmanager.com
8.1 %
212.42 Kb
cdn-eu.usefathom.com
0.1 %
2.85 Kb
googleadservices.com
0.1 %
1.56 Kb
youtube.com
0.0 %
503 B
o4504649999843328.ingest.sentry.io
0.0 %
308 B
google.com
0.0 %
64 B
TOTAL
100%
2.58 Mb
Requests by domain
Domain
Percent
Requests
uclan.ac.uk
69.0 %
40
cdn.cookielaw.org
17.2 %
10
cdn-eu.usefathom.com
3.4 %
2
googletagmanager.com
3.4 %
2
o4504649999843328.ingest.sentry.io
1.7 %
1
youtube.com
1.7 %
1
googleadservices.com
1.7 %
1
google.com
1.7 %
1
TOTAL
100%
58
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.092 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.092 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.725 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.725 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 1.94 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

1.94 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img alt="group of students stood in front a neon UCLan logo..." sizes="130vw" srcset="/image-library/themes/ignite/ignite-campaign-only-..." src="https://www.uclan.ac.uk/image-library/themes/ignit..." decoding="async" data-nimg="true" class="ignite-hero-slider__slide_image__image ignite-hero..." style="position:absolute;top:0;left:0;bottom:0;right:0;bo...">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.1028. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.1028

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Join us Open Days News
Html: <div class="eedtkz-0 fhLDEs ignite-hero-slider__pagination">
Score: 0.0949
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 10
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.uclan.ac.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
www.uclan.ac.uk
Organization
University of Central Lancashire
Location
Lancashire, GB
Subject Alternative Names (SANs)
www.uclan.ac.uk, uclan.ac.uk
Not valid before
Thu, June 6o 2024, 12:00:00 am (z)
Not valid after
Wed, July 2o 2025, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
GEANT OV RSA CA 4
Intermediate certificate
Common name
GEANT OV RSA CA 4
Organization
GEANT Vereniging
Location
NL
Not valid before
Tue, February 18o 2020, 12:00:00 am (z)
Not valid after
Sun, May 1o 2033, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Root certificate
Common name
USERTrust RSA Certification Authority
Organization
The USERTRUST Network
Location
Jersey City, New Jersey, US
Not valid before
Mon, February 1o 2010, 12:00:00 am (z)
Not valid after
Mon, January 18o 2038, 11:59:59 pm (z)
Signature algorithm
sha384WithRsaEncryption
Issuer
USERTrust RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=15768000
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1,shrink-to-fit=no" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 96
Failed: 1
Warnings: 0
Passed: 9
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.uclan.ac.uk/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link data-react-helmet="true" href="https://www.uclan.ac.uk/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 mx a:c.spf.service-now.com ip4:185.194.168.25 ip4:149.72.228.91 ip4:193.61.255.19 ip4:193.61.255.24 ip4:193.61.255.26 ip4:193.61.240.40/29 ip4:193.61.255.52 ip4:54.72.216.88 ip4:54.72.233.224 ip4:52.209.150.35 ip4:52.211.22.72 ip4:52.212.91.71 ip4:" "66.240.227.0/27 ip4" ":63.143.57.0/24 ip4:34.2" "45.210.0/27 ip4:135.84.216.160 ip4:135.84.216.224 ip4:135.84.217.32 ip4:135.84.217.96 ip4:77.73.169.120/23 ip4:54.69.74.101 ip4:52.27.209.75 ip4:52.89.105.251 ip4:52.27.103.191 ip4:193.61.255.18 ip4:78.137.123.198 ip4:31.186.226.0/24 ip4:185.20.211.0/24 i" "p4:185.172.199.128/26 ip4:185.172.199.192/27 ip4:185.18.138.5 ip4:185.172.199.56/29 include:wpm.flywire.com include:spf.mandrillapp.com include:mh.blackboard.com include:spf.protection.outlook.com -all
Ads.txt Validation Test68% of top 100 sites passed
  • The request of ads.txt file has an unexpected Content-Type header: text/html; charset=utf-8. In order for this resource to be easily accessed by the DSPs and advertisers, its Content-Type header should be text/plain or text/plain; charset=utf-8.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved