seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
https://www.terastore.cz
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 103 out of 100, which is higher than the average score of 75. Our analysis has identified 11 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
11 Failed
1 Warnings
36 Passed
Common SEO issues
Score: 80
Failed: 2
Warnings: 1
Passed: 14
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: TERASTORE.cz | Prodejce počítačů a elektroniky
Meta Description
  • Congratulations! Your webpage is using a meta description tag
Text: Prodáváme levné notebooky, předváděcí notebooky, repasované notebooky, nové notebooky, repasované počítače, předváděcí počítače a příšlušenství. Široká nabídka produktů značek HP, Lenovo, Dell, Asus, Acer, Fujitsu, Toshiba.
Google Search Results Preview
Desktop version
https://www.terastore.czTERASTORE.cz | Prodejce počítačů a elektronikyProdáváme levné notebooky, předváděcí notebooky, repasované notebooky, nové notebooky, repasované počítače, předváděcí počítače a příšlušenství. Široká nabídka produktů značek HP, Lenovo, Dell, Asus, Acer, Fujitsu, Toshiba.
Mobile version
https://www.terastore.czTERASTORE.cz | Prodejce počítačů a elektronikyProdáváme levné notebooky, předváděcí notebooky, repasované notebooky, nové notebooky, repasované počítače, předváděcí počítače a příšlušenství. Široká nabídka produktů značek HP, Lenovo, Dell, Asus, Acer, Fujitsu, Toshiba.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
36přidat22intel19splátky19produkt18windows
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud
adímeakčníchatomba072nlblogbookbraswellbridgebroadwellbs004nebw020nbcherrycookiescoreddr3ldoplňkydoporučendoporučujemeelektronikyelitebookfirmygeforcegraphicsheslohomeideacentreideapadintelinternetovještkabykomponentykontaktykošíkkošíkulakelenovomezimobilymožnostimístynabídeknemáteneskutečnnotebookynvidiaobchodoblíbenýmodběruosobníchpentiumpobočkamiporovnatpovinenpočítapočítačeprodejceproduktproduktyprofessionalprázdnprémiovpřednpředváděcpřehledpřidatpřihlastepřihlásitpřihlášenquadroradeonregistracerepasovanrepasysandysklademskylakeslevyslužebsouhlasímsplátkystoneytabletyterastore.cztrailtrvalvelkvyhledatvytvořenvýdejnímiwebuwindowsx5-zx91lyogazapomenutzaregistrujtezpracovánímzákazníkazískejte
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
TERASTORE.cz | Prodejce počítačů a elektroniky
H2 tags
HP EliteBook 8560w
HP 15-bw020nb
Lenovo IdeaCentre AIO 720-24IKB
Lenovo Yoga Book X91L
HP 15-ba072nl
Lenovo IdeaPad 110-15IBR
HP 15-bs004ne
Lenovo IdeaPad G50-80
PŘIHLASTE SE K ODBĚRU AKČNÍCH NABÍDEK
Kontakty
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Deprecated HTML Tags
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
36u
Google Analytics Test
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 43
Failed: 5
Warnings: 0
Passed: 3
HTML Page Size Test
  • Congratulations! The size of your webpage's HTML is 9.63 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 66.95 Kb to 9.63 Kb (86% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 8.6 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 59
  • 2 HTML Pages
  • 5 CSS Files
  • 19 JS Files
  • 33 Images
  • 0 Flash Files
Image Caching Test
  • Congratulations! Your webpage is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
URL Redirects Checker
  • Your URL performed 3 redirects! Avoid chained redirects if possible, as this may cause search engine indexing problems and adversely affect site loading time.
Server and security
Score: 80
Failed: 1
Warnings: 0
Passed: 2
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We've found 2 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 100
Failed: 0
Warnings: 0
Passed: 6
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage does not use the canonical link tag.
Nofollow Checker
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 mx a ip4:176.74.217.33 include:_emailing.heureka.cz ~all

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2025 • All rights reserved