seo site checkup logo
PricingFree ToolsArticles
Report generated a year ago
https://tajukkelana.com
Your general SEO Checkup Score
Archived
81/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 81 out of 100, which is higher than the average score of 74. Our analysis has identified 10 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
2 Warnings
58 Passed
Issues to fix
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
To ensure that Search Engines can accurately identify the topic of this webpage, it is important to include the most common keywords in the title tag, meta description, and heading tags.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
By creating a custom 404 error page with helpful links and information, users are more likely to stay on the site and continue to explore.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Reducing the Document Object Model (DOM) size can lead to faster page loading times, improved site performance, and better user experience by decreasing the amount of time it takes for the browser to process and render the page.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 66
Failed: 5
Warnings: 2
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: Tajuk Kelana Berbagi Informasi, Cerita, Dan Berita
Length: 50 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 37 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Berbagi Informasi, Cerita, dan Berita
Length: 37 characters
Google Search Results Preview Test
Desktop version
https://tajukkelana.com/Tajuk Kelana Berbagi Informasi, Cerita, Dan BeritaBerbagi Informasi, Cerita, dan Berita
Mobile version
https://tajukkelana.com/Tajuk Kelana Berbagi Informasi, Cerita, Dan BeritaBerbagi Informasi, Cerita, dan Berita
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:title
Tajuk Kelana Berbagi Informasi, Cerita, Dan Berita
og:description
Tajuk Kelana merupakan sebuah website berbagi cerita, informasi dan juga berita. Banyak yang kami bahas di website ini, namun kesemua itu berfokus pada satu tujuan. Yakni Berbagi apa yang ada di sekeliling kami
og:url
https://tajukkelana.com/
og:type
website
og:locale
en_US
og:site_name
Tajuk Kelana
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
30yang23dengan19kamu18cara15tikus
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are not distributed across the important HTML tags! Primary keywords should appear in title tag, meta description and heading tags to help Search Engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
yang
dengan
kamu
cara
tikus
Keywords Cloud Test
adalahagarakanasliataubacaanbahasabarangbarusbelajarbelakangberinteraksibisabisniscaracepatcontentdalamdapatdaridengandipahamiefektifgayahiburanhiduphijauhobiindonesiainggrisjenisjikajugakamarkamukapurkejantanankelanakitaklancengkucinglainnyamadumanfaatmasalahmelaksanakanmengkosntruksimengusirmenjadimerekamerupakanmodelmotivasimudahonlinepadapelatihpembelajaranpendidikanpengetahuanperlupesantrenpesertapondokpriapropertirambutresultsrumahrumahmusalafsalahsatusawahsearchsebagaisehatsemuasepertisesamasetelahsholatsinisolusisunnahtahajudtajuktanamanteknologitemboktemukanterbaiktidaktikustipstoskauntukwaletwarnayang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
Cara Mengusir Tikus di Sawah dengan Kapur Barus
Cara Mengusir Tikus di Kamar: Solusi Efektif dan Ramah Lingkungan
Cara Mengusir Tikus dengan Kapur Barus – Solusi Alami dan Mudah yang Efektif
Biaya Pembuatan Rumah Walet 4×6: Semua yang Perlu kamu Ketahui
Manfaat Madu Klanceng untuk Kejantanan Pria Dewasa
Cara Berinteraksi dengan Sesama Peserta dan Pelatih dalam Pembelajaran Online
Mengkosntruksi Pengetahuan Pada Pembelajaran Online
Cara Belajar Bahasa Inggris dengan Cepat dan Mudah Dipahami
Mengenal Warna Hijau Toska Cat Tembok
Menciptakan Kesegaran dengan Jenis Warna Hijau Cat Tembok
Live Results Search
Recent Posts
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage doesn't have any warnings or errors caught by the Chrome DevTools Console.
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Pinterest Twitter 
Speed optimizations
Score: 87
Failed: 3
Warnings: 0
Passed: 18
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 20.96 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,968 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 122.2 Kb to 20.96 Kb (83% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 2.48 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
59.0 %
533.69 Kb
image
22.9 %
207.15 Kb
html
7.3 %
66.36 Kb
css
6.5 %
59.18 Kb
font
3.1 %
28.16 Kb
other
1.2 %
10.69 Kb
TOTAL
100%
905.23 Kb
Requests by content type
Content type
Percent
Requests
javascript
43.3 %
26
image
23.3 %
14
html
21.7 %
13
other
6.7 %
4
css
3.3 %
2
font
1.7 %
1
TOTAL
100%
60
Content size by domain
Domain
Percent
Size
tajukkelana.com
37.6 %
340.22 Kb
pagead2.googlesyndication.com
29.0 %
262.86 Kb
googletagmanager.com
10.7 %
96.85 Kb
googletagservices.com
5.4 %
48.87 Kb
googleads.g.doubleclick.net
4.7 %
42.16 Kb
tpc.googlesyndication.com
3.9 %
35.71 Kb
fonts.gstatic.com
3.1 %
28.16 Kb
gstatic.com
2.6 %
23.61 Kb
google-analytics.com
2.2 %
20.00 Kb
stats.wp.com
0.3 %
3.10 Kb
Other
0.4 %
3.70 Kb
TOTAL
100%
905.23 Kb
Requests by domain
Domain
Percent
Requests
tajukkelana.com
31.7 %
19
pagead2.googlesyndication.com
11.7 %
7
googleads.g.doubleclick.net
11.7 %
7
tpc.googlesyndication.com
11.7 %
7
google-analytics.com
6.7 %
4
gstatic.com
5.0 %
3
googletagmanager.com
3.3 %
2
adservice.google.com
3.3 %
2
google.com
3.3 %
2
api.sosiago.id
1.7 %
1
Other
10.0 %
6
TOTAL
100%
60
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 10
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "tajukkelana.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sni.cloudflaressl.com
Organization
Cloudflare, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
sni.cloudflaressl.com, *.tajukkelana.com, tajukkelana.com
Not valid before
Sat, July 30o 2022, 12:00:00 am (z)
Not valid after
Sun, July 30o 2023, 11:59:59 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
Cloudflare Inc ECC CA-3
Intermediate certificate
Common name
Cloudflare Inc ECC CA-3
Organization
Cloudflare, Inc.
Location
US
Not valid before
Mon, January 27o 2020, 12:48:08 pm (z)
Not valid after
Tue, December 31o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Root certificate
Common name
Baltimore CyberTrust Root
Organization
Baltimore
Location
IE
Not valid before
Fri, May 12o 2000, 6:46:00 pm (z)
Not valid after
Mon, May 12o 2025, 11:59:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=63072000; includesubdomains; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=5, viewport-fit=cover" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 69
Failed: 2
Warnings: 0
Passed: 8
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is not using a custom 404 error page! Default 404 error pages result in a poor experience - it can mislead users into thinking an entire site is down or broken, greatly increases the chance they leave the website entirely, and looks unprofessional. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://tajukkelana.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://tajukkelana.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:139.162.30.170 +a +mx include:relay.mailchannels.net ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file and its content has a valid format. Since the file is uploaded and maintained by publishers on their own domain, it's not easy for bad players to gain access to it or to change entries. Buyers who want to bid on the publisher's inventory can refer to their ads.txt file and confidently know that the exchange they are dealing with is in fact authorized to directly or indirectly sell the publisher's inventory.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved