seo site checkup logo
PricingFree ToolsArticles
Log in
Report generated 2 months ago
https://www.signsandprintltd.co.uk
Your general SEO Checkup Score
Archived
79/100
SEO Score
10 Failed
6 Warnings
55 Passed
Issues to fix
Last found on Invalid Date
HIGH
This webpage is not using the HTTP/2 protocol!
HIGH
This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
HIGH
This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
HIGH
The loading time of this webpage (measured from N. Virginia, US) is around 5.68 seconds and is greater than the average loading speed which is 5 seconds!
MEDIUM
The Document Object Model (DOM) of this webpage has 4,864 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
MEDIUM
Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
LOW
This webpage has some errors caught by the Chrome DevTools Console!
LOW
We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
LOW
This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
LOW
This webpage is using inline CSS styles!
Common SEO issues
Score: 87
Failed: 3
Warnings: 1
Passed: 22
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 62 characters. While there's no target number of characters, titles should be descriptive and concise. We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: PVC Banners | Pop Up Displays | Roller Banners | Signs & Print
Length: 62 characters
Meta Description Test97% of top 100 sites passed
  • This webpage is using a meta description tag.
Text: Signs and Print Banner Printing & Large Format Specialists Printers based in Braintree, Essex. Buy all kinds of wide format signs and banners from our Essex-based printers. Order online or call now.
Length: 198 characters
Google Search Results Preview Test
Desktop version
https://www.signsandprintltd.co.ukPVC Banners | Pop Up Displays | Roller Banners | Signs & PrintSigns and Print Banner Printing & Large Format Specialists Printers based in Braintree, Essex. Buy all kinds of wide format signs and banners from our Essex-based printers. Order online or call now.
Mobile version
https://www.signsandprintltd.co.ukPVC Banners | Pop Up Displays | Roller Banners | Signs & PrintSigns and Print Banner Printing & Large Format Specialists Printers based in Braintree, Essex. Buy all kinds of wide format signs and banners from our Essex-based printers. Order online or call now.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:type
website
og:url
https://www.signsandprintltd.co.uk/
og:title
PVC Banners | Pop Up Displays | Roller Banners | Signs & Print
og:description
Signs and Print Banner Printing & Large Format Specialists Printers based in Braintree, Essex. Buy all kinds of wide format signs and banners from our Essex-based printers. Order online or call now.
og:image
https://www.signsandprintltd.co.uk/pub/media/logo/stores/1/Signs-and-Print-main-logo.gif
og:site_name
Signs & Print Limited
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
13signs11print10banners9design8graphics
Keywords Usage Test81% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
signs
print
banners
design
graphics
Keywords Cloud Test
acceptaccountarrangeartworkbannerbannersbestblogboardsbrowserbudgetbusinesscablecanvascardscartchalkcheckcheckoutclosecommittedcontactcookiescouriercreatedatedeliverydesigndisplayeasyessexexperienceextraflagsflyersfoldersformatfreefriendlygraphicgraphicshavehelphighinstalljavascriptlabelslargeleafletsliquidlookingmeetmeshongoingonlineorderorderspackpavementpensperfectpolicypostedpostersprintprintedprintingprintsprivacyproductsprofessionalprojectqualityquoterangeratingreadreplacementrequirementsrightrollersearchserviceservicessignsignagesignssitesmallsoftstickersteamtemplatestiestoolsuploadvisitwhitewindowwork
Competitor Domains Test
Understand your competitors' SEO profile

Side-by-side SEO comparisons of up to 5 competitors. See how your SEO can improve against the competition.

Heading Tags Test70% of top 100 sites passed
  • This webpage contains headings tags.
H1 tags
We're The No.1 Leading Banner Printing and Large Format Print Specialists In The UK
H2 tags
Bestseller Products
New Products
Recent Blog Post
PVC banners: the perfect tools for seasonal promotions
Why do we use white ink to create our window graphics?
The everlasting appeal of fluted display boards
Pavement signs: the ultimate marketing tools for brick-and-mortar businesses
HOW WE MAKE PRINTING EASY
our services
brands we've printed for
Robots.txt Test94% of top 100 sites passed
  • Congratulations! Your site uses a "robots.txt" file.
Sitemap Test75% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All "img" tags from this webpage have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • All image display dimensions match the natural aspect ratio.
Inline CSS Test2% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=UTF-8
Social Media Test80% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Need to track more websites?
Get between 3 and 15 monitored websites and supercharge your SEO.
Speed optimizations
Score: 66
Failed: 5
Warnings: 4
Passed: 14
HTML Page Size Test34% of top 100 sites passed
  • The size of this webpage's HTML is 23.19 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 4,864 nodes which is greater than the recommended value of 1,500 nodes! A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 172.35 Kb to 23.19 Kb (87% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • The loading time of this webpage (measured from N. Virginia, US) is around 5.68 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
image
58.9 %
1.77 Mb
javascript
27.6 %
846.85 Kb
font
6.4 %
197.49 Kb
css
5.0 %
153.33 Kb
html
1.9 %
58.35 Kb
other
0.1 %
4.31 Kb
TOTAL
100%
3.00 Mb
Requests by content type
Content type
Percent
Requests
javascript
67.2 %
213
image
19.6 %
62
html
4.7 %
15
css
3.8 %
12
font
2.8 %
9
other
1.9 %
6
TOTAL
100%
317
Content size by domain
Domain
Percent
Size
signsandprintltd.co.uk
81.1 %
2.43 Mb
gstatic.com
5.9 %
181.74 Kb
downloads.mailchimp.com
3.4 %
104.02 Kb
maxcdn.bootstrapcdn.com
2.7 %
83.00 Kb
fonts.gstatic.com
1.5 %
47.19 Kb
googletagmanager.com
1.5 %
46.11 Kb
widget.trustpilot.com
0.9 %
28.12 Kb
google.com
0.7 %
22.37 Kb
google-analytics.com
0.6 %
19.77 Kb
mcusercontent.com
0.6 %
18.20 Kb
Other
1.0 %
29.85 Kb
TOTAL
100%
3.00 Mb
Requests by domain
Domain
Percent
Requests
signsandprintltd.co.uk
88.0 %
279
downloads.mailchimp.com
2.2 %
7
widget.trustpilot.com
1.6 %
5
google.com
1.6 %
5
fonts.gstatic.com
0.9 %
3
gstatic.com
0.9 %
3
maxcdn.bootstrapcdn.com
0.6 %
2
google-analytics.com
0.6 %
2
googletagmanager.com
0.3 %
1
chimpstatic.com
0.3 %
1
Other
2.8 %
9
TOTAL
100%
317
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test
  • This webpage is not using images with large metadata.
Image Caching Test99% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test97% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Largest Contentful Paint Test
  • The Largest Contentful Paint duration of this webpage is 3.62 seconds. To provide a good user experience, sites should strive to have Largest Contentful Paint of 2.5 seconds or less.
Largest Contentful Paint element within the viewport:
<img src="https://www.signsandprintltd.co.uk/pub/media/Banne..." alt="pvc banner printing">
Cumulative Layout Shift Test
  • The CLS score of this webpage is 0.181. To provide a good user experience, sites should strive to have a CLS score of 0.1 or less.
DOM element which contributes the most to CLS score:
Text: BESTSELLER PRODUCTS Cable Ties - 300mm x 4.5mm Pack of 25 £2.99 Booster A-Board ...
Html: <main id="maincontent" class="page-main">
Score: 0.1755
Track up to 5 competitors 24/7
Analyze SEO metrics & get important information about your competition.
Server and security
Score: 82
Failed: 2
Warnings: 0
Passed: 7
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.signsandprintltd.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
signsandprintltd.co.uk
Subject Alternative Names (SANs)
signsandprintltd.co.uk, cpanel.signsandprintltd.co.uk, cpcalendars.signsandprintltd.co.uk, cpcontacts.signsandprintltd.co.uk, mail.signsandprintltd.co.uk, webdisk.signsandprintltd.co.uk, webmail.signsandprintltd.co.uk, www.signsandprintltd.co.uk
Not valid before
Not valid after
Signature algorithm
sha256WithRsaEncryption
Issuer
cPanel, Inc. Certification Authority
Intermediate certificate
Common name
cPanel, Inc. Certification Authority
Organization
cPanel, Inc.
Location
Houston, TX, US
Not valid before
Not valid after
Signature algorithm
sha384WithRsaEncryption
Issuer
COMODO RSA Certification Authority
Root certificate
Common name
COMODO RSA Certification Authority
Organization
COMODO CA Limited
Location
Salford, Greater Manchester, GB
Not valid before
Not valid after
Signature algorithm
sha384WithRsaEncryption
Issuer
COMODO RSA Certification Authority
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is not using the HTTP/2 protocol!
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test93% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Monitor your website keywords
Get useful insights and detailed metrics for your most important keywords.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1" />
Media Query Responsive Test99% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Your branded PDF Report is almost ready
Wow your clients with white labeled SEO Reports.
Advanced SEO
Score: 98
Failed: 0
Warnings: 1
Passed: 9
Structured Data Test59% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test99% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.signsandprintltd.co.uk is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.signsandprintltd.co.uk/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • The robots.txt file disallow the search engines access to some parts of your website! You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:92.205.26.7 include:secureserver.net exists:%{i}.mta.spf.extendcp.co.uk exists:%{i}.web.spf.extendcp.co.uk -all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.

Check your website's SEO for free right now!

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2009-2022 • All rights reserved