seo site checkup logo
PricingFree ToolsArticles
Report generated 8 years ago
https://pakdehfurniture.com/jasa-kitchen-set-murah-di-bogor
Your general SEO Checkup Score
Archived
100/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 130 out of 100, which is higher than the average score of 75. Our analysis has identified 6 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
6 Failed
2 Warnings
33 Passed
Common SEO issues
Score: 88
Failed: 1
Warnings: 1
Passed: 10
Google Search Results Preview
Desktop version
https://pakdehfurniture.com/jasa-kitchen-set-murah-di-bogor/√ Jasa Kitchen Set Murah Di Bogor | Pak Deh FurniturePesan Jasa Kitchen Set Murah Di Bogor Sekarang, Dan Wujudkan Impian Memiliki Kitchen Set Minimalis modern. Kami Jual Kitchen Set di bogor dengan Desain Modern
Mobile version
https://pakdehfurniture.com/jasa-kitchen-set-murah-di-bogor/√ Jasa Kitchen Set Murah Di Bogor | Pak Deh FurniturePesan Jasa Kitchen Set Murah Di Bogor Sekarang, Dan Wujudkan Impian Memiliki Kitchen Set Minimalis modern. Kami Jual Kitchen Set di bogor dengan Desain Modern
Keywords Cloud
adalahakanandaataubahwabandingkanbarubawahbiayabilabisabogorbuatbuatkanbudgetbukancabinetcaracommentsdapatdapurdaridengandesaindesignemailfurniturehanyahargaharushasilnyahomehubungiingininginkaninteriorjaminjasajualkaliankamikarenakhususkitakitchenkonsultasikualitaslainyalangsunglemariluarmakamasalahmasihmatangmelainkanmemangmemesanmemilikimencarimenjadiminimalismodernmurahnotifypadapakaianpembuatanpentingperancanaanpesanpostpostsproduksirencanakanreplyruanganrumahsajasamasangatsayasedangsekalisemuasepertisesuaisudahsurveytampilantapitenangtidaktinggaltinggitukanguntukvendorwhatsapp/telponyang
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! We've found 2 sitemaps files for your website:
Image Alt Test
  • Your webpage has 13 'img' tags and 2 of them are missing the required 'alt' attribute.
See full list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • Congratulations! Your website is using the latest version of Google Analytics.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your web page.
Speed optimizations
Score: 97
Failed: 1
Warnings: 1
Passed: 4
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your page is successfully compressed using gzip compression on your code.
    Your HTML is compressed from 42.48 Kb to 10.20 Kb (76 % size savings). This helps ensure a faster loading web page and improved user experience.
Site Loading Speed Test
  • Your site loading time is around 4.379 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 89
  • 3 HTML Pages
  • 22 CSS Files
  • 39 JS Files
  • 25 Images
  • 0 Flash Files
Image Caching Test
  • Congratulations! Your webpage use 'Expires' header for your images and the browsers will display these images from the cache.
URL Redirects Checker
  • Your URL performed one redirect! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 100
Failed: 0
Warnings: 0
Passed: 3
HTTPS Test
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 0
Failed: 1
Warnings: 0
Passed: 1
Media Query Responsive Test
  • Your website is not using media queries. You should consider using this technique in order to implement responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Microdata Schema Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your page is using the canonical link tag. This tag specifies that the URL: https://pakdehfurniture.com/jasa-kitchen-set-murah-di-bogor is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link rel="canonical" href="https://pakdehfurniture.com/jasa-kitchen-set-murah-di-bogor/" />
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
Disallow Directive Checker
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF records checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved