seo site checkup logo
PricingFree ToolsArticles
Report generated a month ago
https://forbes.com
Your general SEO Checkup Score
Archived
74/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 74 out of 100, which is the same as the average score of 74. Our analysis has identified 14 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
14 Failed
6 Warnings
54 Passed
Issues to fix
HIGH
It is recommended to avoid URL parameters and to use hyphens to separate words in the URL structure, rather than underscores.
HIGH
H1 and H2 tags ensure better search engine visibility and ranking by providing structure and hierarchy to the content, improving readability, and providing opportunities for keyword optimization.
HIGH
Using images in a modern format can significantly reduce the file size and improve the loading speed of a webpage, providing a better user experience and potentially increasing engagement.
HIGH
Users may abandon pages that take longer than 5 seconds to load, resulting in a potential loss of up to 50% of visitors. Faster loading pages can lead to increased traffic, better conversions, and higher sales.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Reducing the JavaScript execution time can result in faster page load times and a smoother user experience, as it allows the browser to render and display the page more quickly.
MEDIUM
JavaScript errors can impact user experience and may prevent users from viewing the page properly.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Resolving errors identified by the Chrome DevTools Console can improve user experience.
LOW
To protect against spam harvesters, consider hiding or obfuscating email addresses in your page code.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
Common SEO issues
Score: 60
Failed: 6
Warnings: 3
Passed: 17
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag with a length of 6 characters. While there's no target number of characters, titles should be descriptive and concise. Using a title tag with less than 20 characters is a missed opportunity since it can be difficult to fit all your targeted keywords in such a short text.
    We recommend using a title with a length between 20 - 60 characters in order to fit Google Search results that have a 600-pixel limit.
Text: Forbes
Length: 6 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 123 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Forbes is a global media company, focusing on business, investing, technology, entrepreneurship, leadership, and lifestyle.
Length: 123 characters
Google Search Results Preview Test
Desktop version
https://www.forbes.com/ForbesForbes is a global media company, focusing on business, investing, technology, entrepreneurship, leadership, and lifestyle.
Mobile version
https://www.forbes.com/ForbesForbes is a global media company, focusing on business, investing, technology, entrepreneurship, leadership, and lifestyle.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
Forbes
og:title
Forbes
og:url
https://www.forbes.com/
og:image
https://imageio.forbes.com/i-forbesimg/media/assets/forbes_1200x1200.jpg?format=jpg&fit=bounds
og:image:type
image/jpeg,image/gif,image/png
og:description
Forbes is a global media company, focusing on business, investing, technology, entrepreneurship, leadership, and lifestyle.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
97forbes11staff9council8hours7premium
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
forbes
staff
council
hours
premium
Keywords Cloud Test
accountadchoicesadvisoragreeamericaamericansarticlesasiaautobidenbillionairebillionairesbitcoinbreakingbusinesscasechanchinaciticontributorcouncilcourtcreatedailydecipheringeconomyeditionenjoyeuropefacebookfieldforbesgoogleguocolandheadhighhourshousingincomeinformationinsideinvestinginvestorknowleadershiplenglikelimitmarketmetsmikeminutesmoneynewsnewslettersoperatingpersonalpreferencespremiumprivacyprojectprophetputinquekquotereasonrecordregistersavesayssellsellsseniorserviceshareshroomsignsingaporestaffstatementstepstinksstoriessubscribesubscriptionsupremetermsthinktiktoktodaytraveltruetrumpvettedvietnamwatchweekendwinsyakowiczyork
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage does not contain H1 headings! H1 headings help indicate the important topics of your page to search engines. While less important than good meta-titles and descriptions, H1 headings may still help define the topic of your page to search engines.
H2 tags
David Hodges founded San Francisco’s Church of Ambrosia on the belief that psychedelic mushrooms are a sacrament that can reveal life’s true purpose. Inside America’s largest—and trippiest—megachurch.
Featured
Money
Video
MrBeast Shares His Hopes For His Legacy
Lifestyle
Leadership
Innovation
Business
Small Business
Billionaires
Forbes Vetted
Advisor
Home Improvement
Conferences
Newsletters
Products
Company Info
Forbes Councils
Education
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • This webpage contains URLs that are not SEO friendly!
See results list
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • All images in this webpage are properly sized for different users' viewports.
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • We've found JavaScript errors on this webpage!
See results list
Console Errors Test41% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 75
Failed: 5
Warnings: 2
Passed: 18
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,114 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using gzip compression on your code. The HTML code is compressed from 1042.26 Kb to 191.43 Kb (82% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 12.29 seconds and is greater than the average loading speed which is 5 seconds!
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in more than 3.5 seconds! When the JavaScript code takes a long time to execute, it slows down the page performance in several ways: longer download times, main thread bottlenecks, delays of "Time To Interactive", memory leaks, etc.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
other
38.3 %
3.25 Mb
javascript
32.2 %
2.73 Mb
image
23.8 %
2.02 Mb
html
3.1 %
273.37 Kb
font
2.3 %
197.10 Kb
css
0.4 %
30.45 Kb
TOTAL
100%
8.49 Mb
Requests by content type
Content type
Percent
Requests
image
43.6 %
171
javascript
21.2 %
83
other
18.9 %
74
html
12.8 %
50
font
2.3 %
9
css
1.3 %
5
TOTAL
100%
392
Content size by domain
Domain
Percent
Size
images.forbes.com
34.7 %
2.94 Mb
imageio.forbes.com
20.0 %
1.70 Mb
i.forbesimg.com
5.1 %
443.63 Kb
googletagmanager.com
4.1 %
358.33 Kb
forbes.com
3.6 %
313.67 Kb
z.moatads.com
2.8 %
239.88 Kb
tpc.googlesyndication.com
2.7 %
236.62 Kb
gstatic.com
2.6 %
224.84 Kb
securepubads.g.doubleclick.net
2.3 %
202.83 Kb
warp.media.net
2.1 %
184.53 Kb
Other
20.0 %
1.70 Mb
TOTAL
100%
8.49 Mb
Requests by domain
Domain
Percent
Requests
imageio.forbes.com
4.3 %
17
s.amazon-adsystem.com
4.3 %
17
forbes.com
3.6 %
14
simage2.pubmatic.com
3.3 %
13
dt.adsafeprotected.com
3.1 %
12
i.forbesimg.com
2.8 %
11
google.com
2.8 %
11
pixel.adsafeprotected.com
2.6 %
10
fundingchoicesmessages.google.com
2.6 %
10
prebid-s2s.media.net
2.3 %
9
Other
68.4 %
268
TOTAL
100%
392
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is not serving all resources (images, javascript and css) from CDNs!
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is not serving images in a modern format! Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Metadata Test72% of top 100 sites passed
  • This webpage is not using images with large metadata.
Image Caching Test97% of top 100 sites passed
  • This webpage is not using uncached images from same domain.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is not using render-blocking resources.
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.015 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.015 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.205 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.205 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 0.23 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

0.23 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<div class="preview__image preview__image--non-progressive" style="background-image: url(https://imageio.forbes.com/s...">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0054. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.

0.0054

0.1

0.25

DOM element which contributes the most to CLS score:
Text: Subscribe To Newsletters
Html: <div id="subscribeToNewsLetters">
Score: 0.0054
Server and security
Score: 83
Failed: 2
Warnings: 1
Passed: 7
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.forbes.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
*.forbes.com
Subject Alternative Names (SANs)
*.forbes.com
Not valid before
Fri, March 15o 2024, 3:33:11 pm (z)
Not valid after
Wed, April 16o 2025, 3:33:10 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign Atlas R3 DV TLS CA 2024 Q1
Intermediate certificate
Common name
GlobalSign Atlas R3 DV TLS CA 2024 Q1
Organization
GlobalSign nv-sa
Location
BE
Not valid before
Wed, October 18o 2023, 4:09:32 am (z)
Not valid after
Sat, October 18o 2025, 12:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign
Root certificate
Common name
GlobalSign
Organization
GlobalSign
Not valid before
Wed, March 18o 2009, 10:00:00 am (z)
Not valid after
Sun, March 18o 2029, 10:00:00 am (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
GlobalSign
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol but not all resources are served over this protocol!
See results list
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=31536000; includesubdomains; preload
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • We've found 1 email addresses in your page code! We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1,maximum-scale=5,minimum-scale=1,user-scalable=yes" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 96
Failed: 1
Warnings: 0
Passed: 9
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://www.forbes.com/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.forbes.com/" rel="canonical"/>
Nofollow Tag Test
  • This webpage does not use the nofollow meta tag. This means that search engines will crawl all links from this webpage.
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 ip4:13.92.238.131 include:us._netblocks.mimecast.com include:_spf.google.com include:et._spf.pardot.com include:servers.mcsv.net include:emailus.freshservice.com include:_spf.salesforce.com include:fdspfus.freshemail.io include:sendgrid.net -all
Ads.txt Validation Test68% of top 100 sites passed
  • This website is using an Authorized Digital Sellers (ads.txt) file, but its content has invalid records! Having errors in this file would cause advertisers to not recognize and ignore the authorized sellers list and that will lead to lost revenue.
See results list
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved