seo site checkup logo
PricingFree ToolsArticles
Report generated 7 years ago
http://financialservicesinc.ubs.com/team/promus
Your general SEO Checkup Score
Archived
83/100
SEO Score
Average SEO score of top 100 sites: 75%
This webpage received an SEO score of 83 out of 100, which is higher than the average score of 75. Our analysis has identified 16 SEO issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
16 Failed
2 Warnings
30 Passed
Common SEO issues
Score: 86
Failed: 2
Warnings: 1
Passed: 14
Meta Title Test
  • Congratulations! Your webpage is using a title tag
Text: Indianapolis, IN Financial Advisors | Promus Wealth Management Group | UBS United States
Meta Description Test
  • Congratulations! Your webpage is using a meta description tag
Text: Promus Wealth Management Group is a UBS Financial Services Team located in Indianapolis, IN. Promus Wealth Management Group strives to provide advice tailored to your individual circumstances and all you'd like your wealth to achieve.
Google Search Results Preview Test
Desktop version
http://financialservicesinc.ubs.com/team/promusIndianapolis, IN Financial Advisors | Promus Wealth Management Group | UBS United StatesPromus Wealth Management Group is a UBS Financial Services Team located in Indianapolis, IN. Promus Wealth Management Group strives to provide advice tailored to your individual circumstances and all you'd like your wealth to achieve.
Mobile version
http://financialservicesinc.ubs.com/team/promusIndianapolis, IN Financial Advisors | Promus Wealth Management Group | UBS United StatesPromus Wealth Management Group is a UBS Financial Services Team located in Indianapolis, IN. Promus Wealth Management Group strives to provide advice tailored to your individual circumstances and all you'd like your wealth to achieve.
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
12plan11retirement10help8wealth7financial
Keywords Usage Test
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
accessaccountadviceadvisorapproachassetsbankbenefitsblvdchooseclientclientscollectivecontactcontentcorporatecreatecrossingcustomizeddecision-makersdecisionsdeliveringdesignedemployeesenrollenrollingexperiencefamiliesfamilyfiduciaryfinancialfloorfuturegenerationsglobalgroupguidehelphomeimportantimproveindianapolisindividualindividualsindustryinsightsinstitutionalinstitutionsinvestinginvestmentknowledgelegacylevellifestylelifetimelinksliquidityloginloginslongevitymakemanagemanagementmeetnavigationneednewsletterobjectivesonlineparticipantsplanplanningplansportalprivatepromuspromus@ubs.comquarterlyresponsibilitiesretirementriversecondserviceservicesshapesiteskipsolutionssourcesponsorsponsorsstockstrategiesstrategyteamtitletodaywealthwe’reyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Congratulations! Your webpage contains headings tags.
H1 tags
Promus Wealth Management Group
H2 tags
Skip Links
Service navigation
Second Level Navigation
Create your plan. Shape your future.
Robots.txt Test
  • This website is using a robots.txt file.
Sitemap Test
  • Congratulations! Your website has a sitemap file.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Deprecated HTML Tags Test
  • We found some HTML deprecated tags. You are advised to change these old tags with equivalent tags or proper CSS rules.
1center
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test
  • Congratulations! There are no severe JavaScript errors on your webpage.
Speed optimizations
Score: 40
Failed: 5
Warnings: 1
Passed: 2
HTML Page Size Test
HTML Compression/GZIP Test
  • Your webpage doesn't use any HTML compression! You should compress your HTML to reduce your page size and page loading times - this will help your site retain visitors and increase page views. If you were using compression, you could be compressing your HTML size by 79% - from 36.33 Kb to 7.5 Kb .
Site Loading Speed Test
  • Your website loading time is around 9.53 seconds and is over the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects Test
Total Objects: 55
  • 7 HTML Pages
  • 9 CSS Files
  • 18 JS Files
  • 21 Images
  • 0 Flash Files
Image Caching Test
  • Your site is not using cache headers for your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test
  • Congratulations! Your website's CSS files are minified!
See results list
URL Redirects Test
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 0
Failed: 3
Warnings: 0
Passed: 0
URL Canonicalization Test
HTTPS Test
Plaintext Emails Test
  • We've found 3 email addresses in your page code. We advise you to protect email links in a way that hides them from the spam harvesters.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 80
Failed: 1
Warnings: 0
Passed: 5
Structured Data Test
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Noindex Tag Test
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test
  • Your webpage does not use the canonical link tag.
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
SPF Records Test
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.

seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2026 • All rights reserved