seo site checkup logo
PricingFree ToolsArticles
Report generated 2 years ago
https://www.ascncfmacademy.com
Your general SEO Checkup Score
Archived
87/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 87 out of 100, which is higher than the average score of 74. Our analysis has identified 9 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
9 Failed
1 Warnings
58 Passed
Common SEO issues
Score: 88
Failed: 4
Warnings: 0
Passed: 22
Meta Title Test100% of top 100 sites passed
  • Congratulations! Your webpage is using a title tag
Text: As chakravarthy ncfm hyderabad stock market technical analysis training
Meta Description Test97% of top 100 sites passed
  • Congratulations! Your webpage is using a meta description tag
Text: Are you searching best Stock Market Courses Training Institute in Hyderabad? To learn Technical Analysis Course, ASC NCFM Academy Hyderabad right place.
Google Search Results Preview Test
Desktop version
https://www.ascncfmacademy.comAs chakravarthy ncfm hyderabad stock market technical analysis trainingAre you searching best Stock Market Courses Training Institute in Hyderabad? To learn Technical Analysis Course, ASC NCFM Academy Hyderabad right place.
Mobile version
https://www.ascncfmacademy.comAs chakravarthy ncfm hyderabad stock market technical analysis trainingAre you searching best Stock Market Courses Training Institute in Hyderabad? To learn Technical Analysis Course, ASC NCFM Academy Hyderabad right place.
Social Media Meta Tags Test83% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:locale
en_US
og:type
website
og:title
A.S.Chakravarthy NCFM Hyderabad: Stock Technical Analysis Training
og:description
Stock Market Training on Technical Analysis Course in Hyderabad, AS Chakravarthy NCFM Academy Hyderabad Ameerpet, is the best NISM Courses Institute
og:url
http://www.ascncfmacademy.com/
og:site_name
A.S.Chakravarthy NCFM Hyderabad
og:image
http://www.ascncfmacademy.com/inimages/ncfm-training-hyderabad-img.jpg
og:image:width
1349
og:image:height
400
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
143hyderabad99market91ncfm89training74stock
Keywords Usage Test81% of top 100 sites passed
  • Congratulations! You are using your keywords in your meta-tags, which help search engines to properly identify the topic of your page.
Keyword(s) included in Title tag
Keyword(s) included in Meta-Description tag
Keywords Cloud Test
academyaddressadvancedameerpetanalysisbestcapitalcareercertificationchakravarthyclassclassescoachingcommodityconceptscoursecoursescurrencydaughterdealersdemoderivativederivativesdoesneffortsemployeeemploymentequityexamplesexchangeexperiencefeesfieldfinancialforexfreefundamentalfundsgivenhavehindihyderabadindiaindianindividualsinstituteinstitutesintradayinvestmentinvestmentsjobsjoinknowknowledgelearnlifelikelivemakemarketmarketsmodulemodulesmutualnationalncfmnearnismonlineopportunitiesoptionspersonpopularpracticalpresentprofessionalprofessionalssectorsecuritiesselfshareskillsstartedstockstrategiesstudentstudentsstyleteachingtechnicaltelanganatelugutimetradingtrainedtrainingvariousvideoswealthyears
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test70% of top 100 sites passed
  • Congratulations! Your webpage contains headings tags.
H1 tags
AS Chakravarthy NCFM Academy Hyderabad - Stock Market Training
H2 tags
Best Stock Market Training Institute in Hyderabad for Real Examples
Best Technical Analysis Training Institute in Hyderabad for Live Trading
REVIEWS : ASC NCFM Academy Hyderabad
NCFM Academy Hyderabad Address
Best Institute for NCFM Courses in Hyderabad
Are you Searching Stock & Share Market Courses Coaching Classes Near Me
Robots.txt Test94% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test75% of top 100 sites passed
  • Congratulations! Your website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test40% of top 100 sites passed
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • All of your webpage's "img" tags have the required "alt" attribute.
Responsive Image Test38% of top 100 sites passed
  • Not all images in this page are properly sized! You are serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test72% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on your site.
See results list
Inline CSS Test2% of top 100 sites passed
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test99% of top 100 sites passed
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test69% of top 100 sites passed
  • Congratulations! Your webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    Congratulations! Your website appears to have a favicon.
JS Error Test74% of top 100 sites passed
  • Congratulations! There are no severe JavaScript errors on your webpage.
Console Errors Test33% of top 100 sites passed
  • This webpage has some errors caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
meta http-equiv="Content-Type" content="text/html; charset=shift_jis"
Social Media Test80% of top 100 sites passed
  • Congratulations! Your website is connected successfully with social media using:
Facebook Twitter 
Speed optimizations
Score: 81
Failed: 4
Warnings: 1
Passed: 15
HTML Page Size Test34% of top 100 sites passed
  • Congratulations! The size of your webpage's HTML is 16.76 Kb and is under the average webpage's HTML size of 33 Kb. Faster loading websites result in a better user experience, higher conversion rates, and generally better search engine rankings.
DOM Size Test17% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 2,686 nodes which is greater than the recommended value of 1,500 nodes. A large DOM size negatively affects site performance and increases the page load time.
HTML Compression/GZIP Test96% of top 100 sites passed
  • Congratulations! Your webpage is successfully compressed using br compression on your code. Your HTML is compressed from 60.48 Kb to 16.76 Kb (72% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test68% of top 100 sites passed
  • Your website loading time is around 1.86 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test79% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • Your page uses more than 20 http requests, which can slow down page loading and negatively impact user experience.
Content size by content type
Content type
Percent
Size
javascript
57.0 %
810.05 Kb
image
29.5 %
419.34 Kb
css
5.3 %
74.74 Kb
html
3.0 %
42.97 Kb
font
2.8 %
39.47 Kb
other
2.5 %
35.13 Kb
TOTAL
100%
1.39 Mb
Requests by content type
Content type
Percent
Requests
javascript
32.6 %
15
image
28.3 %
13
css
17.4 %
8
other
13.0 %
6
html
4.3 %
2
font
4.3 %
2
TOTAL
100%
46
Content size by domain
Domain
Percent
Size
youtube.com
52.1 %
740.71 Kb
ascncfmacademy.com
26.3 %
373.81 Kb
i.ytimg.com
4.8 %
67.98 Kb
fonts.gstatic.com
2.8 %
39.47 Kb
googletagmanager.com
2.7 %
38.37 Kb
code.jquery.com
2.3 %
32.67 Kb
maxcdn.bootstrapcdn.com
2.2 %
30.59 Kb
ajax.googleapis.com
2.1 %
30.39 Kb
jnn-pa.googleapis.com
1.5 %
21.92 Kb
google-analytics.com
1.4 %
19.92 Kb
Other
1.8 %
25.86 Kb
TOTAL
100%
1.39 Mb
Requests by domain
Domain
Percent
Requests
ascncfmacademy.com
39.1 %
18
youtube.com
19.6 %
9
maxcdn.bootstrapcdn.com
4.3 %
2
fonts.gstatic.com
4.3 %
2
jnn-pa.googleapis.com
4.3 %
2
ajax.googleapis.com
2.2 %
1
googletagmanager.com
2.2 %
1
ajax.cloudflare.com
2.2 %
1
fonts.googleapis.com
2.2 %
1
google-analytics.com
2.2 %
1
Other
17.4 %
8
TOTAL
100%
46
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • Congratulations, you have a caching mechanism on your website. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test96% of top 100 sites passed
  • Your webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test32% of top 100 sites passed
  • This webpage is not serving images in a modern format. Image formats like JPEG 2000, JPEG XR, and WebP often provide better compression than PNG or JPEG, which means faster downloads and less data consumption.
See results list
Image Caching Test99% of top 100 sites passed
  • Congratulations! Your website is using cache headers for your images and the browsers will display these images from the cache.
JavaScript Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all JavaScript resources.
CSS Caching Test98% of top 100 sites passed
  • Congratulations! Your website is using cache headers for all CSS resources.
JavaScript Minification Test93% of top 100 sites passed
  • Congratulations! Your website's JavaScript files are minified!
See results list
CSS Minification Test97% of top 100 sites passed
  • Congratulations! Your webpage's CSS resources are minified.
See results list
Render Blocking Resources Test29% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help your page load significantly faster and improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • Congratulations! Your webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Test96% of top 100 sites passed
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 91
Failed: 1
Warnings: 0
Passed: 8
URL Canonicalization Test92% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • Your website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "www.ascncfmacademy.com" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
sni.cloudflaressl.com
Organization
Cloudflare, Inc.
Location
San Francisco, California, US
Subject Alternative Names (SANs)
sni.cloudflaressl.com, *.ascncfmacademy.com, ascncfmacademy.com
Not valid before
Mon, February 21o 2022, 12:00:00 am (z)
Not valid after
Tue, February 21o 2023, 11:59:59 pm (z)
Signature algorithm
ecdsaWithSha256
Issuer
Cloudflare Inc ECC CA-3
Intermediate certificate
Common name
Cloudflare Inc ECC CA-3
Organization
Cloudflare, Inc.
Location
US
Not valid before
Mon, January 27o 2020, 12:48:08 pm (z)
Not valid after
Tue, December 31o 2024, 11:59:59 pm (z)
Signature algorithm
sha256WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Root certificate
Common name
Baltimore CyberTrust Root
Organization
Baltimore
Location
IE
Not valid before
Fri, May 12o 2000, 6:46:00 pm (z)
Not valid after
Mon, May 12o 2025, 11:59:00 pm (z)
Signature algorithm
sha1WithRsaEncryption
Issuer
Baltimore CyberTrust Root
Mixed Content Test (HTTP over HTTPS)100% of top 100 sites passed
  • Congratulations, this webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test92% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
Safe Browsing Test100% of top 100 sites passed
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test88% of top 100 sites passed
  • Congratulations, your server signature is off.
Directory Browsing Test100% of top 100 sites passed
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test93% of top 100 sites passed
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test94% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width, initial-scale=1.0" />
Media Query Responsive Test99% of top 100 sites passed
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 100
Failed: 0
Warnings: 0
Passed: 10
Structured Data Test59% of top 100 sites passed
  • Congratulations! Your website is using HTML Microdata specifications in order to markup structured data.
See results list
Custom 404 Error Page Test75% of top 100 sites passed
  • Congratulations, your website is using a custom 404 error page. By creating a custom 404 error page, you can improve your website's user experience by letting users know that only a specific page is missing/broken (and not your entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links in your site.
Noindex Tag Test99% of top 100 sites passed
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Test95% of top 100 sites passed
  • Your webpage is using the canonical link tag. This tag specifies that the URL: https://www.ascncfmacademy.com is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://www.ascncfmacademy.com" rel="canonical"/>
Nofollow Tag Test
  • Your webpage does not use the nofollow meta tag. This means that search engines will crawl all links from your webpage.
Disallow Directive Test
  • Your robots.txt file disallow the search engines access to some parts of your website. You are advised to check carefully if the access to these resources or pages must be blocked.
See results list
Meta Refresh Test95% of top 100 sites passed
  • Congratulations, this webpage is not using a meta refresh tag.
SPF Records Test94% of top 100 sites passed
  • Congratulations! Your DNS server is using an SPF record.
v=spf1 +a +mx +ip4:162.243.171.191 include:spf.mysecurecloudhost.com ~all
Ads.txt Validation Test80% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved