seo site checkup logo
PricingFree ToolsArticles
Report generated 6 years ago
http://51.75.16.22/inf0sec
Your general SEO Checkup Score
Archived
59/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 59 out of 100, which is below the average score of 74. However, there are 17 important issues that need to be fixed to improve your website's ranking on search engines and enhance its overall performance.
17 Failed
4 Warnings
28 Passed
Common SEO issues
Score: 58
Failed: 7
Warnings: 2
Passed: 12
Meta Title
  • Congratulations! Your webpage is using a title tag
Text: gr3g0v1tch & InfoSec – Information security dedicated
Meta Description
  • The meta description tag is missing from your page. You should include this tag in order to provide a brief description of your page which can be used by search engines. Well-written and inviting meta descriptions may also help click-through rates to your site in search engine results.
Google Search Results Preview
Desktop version
http://51.75.16.22/inf0secgr3g0v1tch & InfoSec – Information security dedicated
Mobile version
http://51.75.16.22/inf0secgr3g0v1tch & InfoSec – Information security dedicated
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
71server38client27public26using25request
Keywords Usage Test
  • Your most common keywords are not appearing in one or more of the meta-tags above. Your primary keywords should appear in your meta-tags to help identify the topic of your webpage to search engines.
Keyword(s) not included in Title tag
Keyword(s) not included in Meta-Description tag
Keywords Cloud
accessaccountaddressaliceapacheapplicationattackaugustauthorbrowsercertificatechangecheckciphercipheredclientcodeconclusionconfigurationconnectioncontainscontentcross-sitedatadestinationdirectorydoesdvwaemployeeencryptedencryptionentriesexchangeexploitationfileflowforgeryforwardgeneratedhackerhandshakehashhttphttpsinformationinternetintroductionknowlayerlet’slinkmailmechanismmessagemitmmysqlnetworknumberosboxes@osboxes:/etc/apache2/sites-availablepacketpagepasswordpostedpre-masterprivateprotocolpublicrandomreferencerelatedremediationrequestrespondsrobots.txtrouterscriptsecuritysendsentseptemberserverserviceshellsignaturesourcesudotabletalktodaytopologyuseduserusersusingvaluevirtualhostvulnerabilitywantswebserverwebsite
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test
  • Your page contains too many H2 tags. H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
gr3g0v1tch & InfoSec
H2 tags
Posts
Introduction
Topology
Detection
Exploitation
Remediation
Conclusion
How does ARP protocol works ?
Technical attack
Network flow explanation
Attack, HTTP inspection
HTTPS inspection
TLS explanation
Posts navigation
Recent Posts
Recent Comments
Archives
Categories
Meta
Robots.txt Test
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load time on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one. Read more about the robots.txt file, and how to create one for your site.
Sitemap Test
  • Your site lacks a sitemap file. Sitemaps can help robots index your content more thoroughly and quickly. Read more on Google's guidelines for implementing the sitemap protocol.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test
  • Congratulations! All links from your webpage are SEO friendly.
Image Alt Test
  • Your webpage contains "img" tags without the required "alt" atribute.
See full list
Inline CSS Test
  • Your webpage is using inline CSS styles!
See results list
Deprecated HTML Tags
  • Congratulations! Your page does not use HTML deprecated tags.
Google Analytics Test
  • A Google Analytics script is not detected on this page. While there are several tools available to monitor your site's visitors and traffic sources, Google Analytics is a free, commonly recommended program to help diagnose potential SEO issues.
Favicon Test
  • Your site either doesn't have a favicon or this has not been referenced correctly.
JS Error Checker
  • Congratulations! There are no severe JavaScript errors on your webpage.
Social Media Check
  • Congratulations! Your website is connected successfully with social media using:
Twitter 
Speed optimizations
Score: 49
Failed: 5
Warnings: 2
Passed: 6
HTML Page Size Test
HTML Compression/GZIP Test
  • Congratulations! Your webpage is successfully compressed using gzip compression on your code. Your HTML is compressed from 120.63 Kb to 33.38 Kb (72% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test
  • Your website loading time is around 3.87 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

Page Objects
Total Objects: 144
  • 1 HTML Pages
  • 3 CSS Files
  • 10 JS Files
  • 130 Images
  • 0 Flash Files
Page Cache Test (Server Side Caching)
  • It does not appear that you are caching your pages. Cached pages serve up static html and avoid potentially time consuming queries to your database. It also helps lower server load by up to 80%. Caching most visibly benefits high traffic pages that access a database, but whose content does not change on every page view. Common caching methods include Alternative PHP Cache, Quickcache, and WP Super Cache (for Wordpress sites). Caching mechanisms also typically compress HTML, further reducing page size and load time.
Flash Test
  • Congratulations! Your website does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
Image Caching Test
  • Your site is not using cache headers for all of your images. The cache headers can help speed up the serving of your webpages for users that regularly visit your site and see the same images. Learn more about how to add expires headers to your images.
See results list
JavaScript Minification Test
  • Some of your website's JavaScript files are not minified!
See results list
CSS Minification Test
  • Some of your website's CSS files are not minified!
See results list
Nested Tables Test
  • Congratulations, your page does not use nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test
  • Congratulations! Your webpage does not use frames.
Doctype Test
  • Congratulations! Your website has a doctype declaration:
<!DOCTYPE html>
URL Redirects Checker
  • Your URL performed 1 redirects! While redirects are typically not advisable (as they can affect search engine indexing issues and adversely affect site loading time), one redirect may be acceptable, particularly if the URL is redirecting from a non-www version to its www version, or vice-versa.
Server and security
Score: 66
Failed: 2
Warnings: 0
Passed: 4
URL Canonicalization Test
HTTPS Test
Safe Browsing Test
  • This site is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test
  • Congratulations, your server signature is off.
Directory Browsing Test
  • Congratulations! Your server has disabled directory browsing.
Plaintext Emails Test
  • Congratulations! Your webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 2
Media Query Responsive Test
  • Congratulations, your website uses media query technique, which is the base for responsive design functionalities.
Mobile Snapshot
Mobile view
Advanced SEO
Score: 60
Failed: 3
Warnings: 0
Passed: 4
Microdata Schema Test
  • Your webpage doesn't take the advantages of HTML Microdata specifications in order to markup structured data. View Google's guide for getting started with microdata.
Noindex Checker
  • Your webpage does not use the noindex meta tag. This means that your webpage will be read and indexed by search engines.
Canonical Tag Checker
  • Your webpage does not use the canonical link tag.
Nofollow Checker
  • Your webpage is using the nofollow meta tag. You are advised to use this tag carefully since search engines will not crawl all links from your webpage.
See results list
Disallow Directive Checker
  • Your site lacks a "robots.txt" file. This file can protect private content from appearing online, save bandwidth, and lower load on your server. A missing "robots.txt" file also generates additional errors in your apache log whenever robots request one.
SPF records checker
  • Your DNS server is not using an SPF record. SPF (Sender Policy Framework) allows administrators to specify which hosts are allowed to send mail from a given domain by creating a specific SPF record or TXT record in the Domain Name System (DNS). You can find more information about SPF records here.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved