seo site checkup logo
PricingFree ToolsArticles
Report generated 12 days ago
https://touchedoutmama.co.uk
Your general SEO Checkup Score
Archived
85/100
SEO Score
Average SEO score of top 100 sites: 74%
This website received an SEO score of 85 out of 100, which is higher than the average score of 74. Our analysis has identified 10 important issues that can be addressed to further enhance your website's performance and improve its search engine visibility.
10 Failed
4 Warnings
60 Passed
Issues to fix
HIGH
To improve the website experience for your visitors, it is recommended to eliminate any render-blocking resources on this webpage.
HIGH
Add descriptive and relevant "alt" attributes to all "img" tags to improve website accessibility.
HIGH
Consider reducing the HTML size to improve loading times and retain visitors.
MEDIUM
Serve properly sized images to reduce page loading times and to improve user's experience.
MEDIUM
Avoid using distorted images, as they can have a negative impact on the user experience.
MEDIUM
Avoid performance and security issues by adding "rel=noopener" or "rel=noreferrer" to your "target=_blank" links.
LOW
Using more than 20 HTTP requests on a webpage can negatively impact the loading time.
LOW
Consider moving inline CSS styles to an external stylesheet to improve site performance and maintain separation of content and design.
LOW
Strip out any unnecessary metadata to improve loading time, security, and privacy. Metadata should not exceed 16% of the image size.
Common SEO issues
Score: 74
Failed: 4
Warnings: 3
Passed: 19
Meta Title Test100% of top 100 sites passed
  • This webpage is using a title tag.
Text: touched out mama shop | Style to latch on to
Length: 44 characters
Meta Description Test96% of top 100 sites passed
  • This webpage is using a meta description tag with a length of 303 characters. We recommend using well-written and inviting meta descriptions with a length between 150 and 220 characters (spaces included).
Text: Welcome to touched out mama! Empowering modern mamas with style and comfort, our collection celebrates the journey of motherhood. Sign up for a 10% discount on your first order. From breastfeeding-friendly hoodies to versatile maternity tops, our clothing is designed to support you through every stage.
Length: 303 characters
Google Search Results Preview Test
Desktop version
https://touchedoutmama.co.uk/touched out mama shop | Style to latch on toWelcome to touched out mama! Empowering modern mamas with style and comfort, our collection celebrates the journey of motherhood. Sign up for a 10% discount on your first order. From breastfeeding-friendly hoodies to versatile maternity tops, our clothing is designed to support you through every stage.
Mobile version
https://touchedoutmama.co.uk/touched out mama shop | Style to latch on toWelcome to touched out mama! Empowering modern mamas with style and comfort, our collection celebrates the journey of motherhood. Sign up for a 10% discount on your first order. From breastfeeding-friendly hoodies to versatile maternity tops, our clothing is designed to support you through every stage.
Social Media Meta Tags Test89% of top 100 sites passed
  • This webpage is using social media meta tags.
Open Graph Meta Tags
og:site_name
touched out mama
og:url
https://touchedoutmama.co.uk/
og:title
touched out mama shop | Style to latch on to
og:type
website
og:description
Welcome to touched out mama! Empowering modern mamas with style and comfort, our collection celebrates the journey of motherhood. Sign up for a 10% discount on your first order. From breastfeeding-friendly hoodies to versatile maternity tops, our clothing is designed to support you through every stage.
og:image
http://touchedoutmama.co.uk/cdn/shop/files/Touched_Out_Mama_Final_Favicon_for_tiktok.png?v=1713783767
og:image:secure_url
https://touchedoutmama.co.uk/cdn/shop/files/Touched_Out_Mama_Final_Favicon_for_tiktok.png?v=1713783767
og:image:width
1720
og:image:height
1764
Most Common Keywords Test
  • There is likely no optimal keyword density (search engine algorithms have evolved beyond keyword density metrics as a significant ranking factor). It can be useful, however, to note which keywords appear most often on your page and if they reflect the intended topic of your page. More importantly, the keywords on your page should appear within natural sounding and grammatically correct copy.
25view25post24price12regular10mama
Keywords Usage Test45% of top 100 sites passed
  • The most common keywords of this webpage are distributed well across the important HTML tags. This helps search engines to properly identify the topic of this webpage.
Keyword
Title tag
Meta description
Headings
view
post
price
regular
mama
Keywords Cloud Test
availabilitybabywearingbestbreastfeedingcalculatedcartcatalogcheckcheckoutchooseclubcolourcombocommentcontactcontentcontinuecosycrossdatedepressiondiamonddiscountsdoingdribbleensembleestimatedeventsfacebookfeaturedfollowfreefriendfriendlygifthavehealthhelphelplinehomehoodiehoodiesincludedinformationinformedinstagraminstructionslatchlikeloadingmamamamasmatchingmaternitymeetsmumsoptionsorderouodpatternpolicypostpriceproductspurchasereceiveregularsalescrunchiesearchshippingshopshoppingsignsignpostingskipsleepingsleevelessspecialsquarestaystorestylesubjectsupportedsustainabletiktoktodaytotaltouchedtouchedoutmamaturnunitupdatevendorviewvillagewearwelcomeyoutube
Competitor Domains Test
Understand your competitors' SEO and backlink profile

Get related competitors and their domain authority score in relation to your domain.

Heading Tags Test59% of top 100 sites passed
  • This webpage contains too many H2 tags! H2 tags should re-inforce the related content of your page to search engines - too many tags may make the topic less clear, or look like spam tactics. Consider using less than 10 H2 tags.
H1 tags
Stay Social @touchedoutmama
Reaching out for help.
H2 tags
Your cart is empty
Your cart
Estimated total
Style to latch on to
Featured products
Wear it your way
Friendly & Sustainable
“Being heard is so close to being loved that for the average person, they are almost indistinguishable.” David Augsburger
Reviews
Follow Us
Sign up and get 10% off your first order💝*Full priced items only.
Robots.txt Test99% of top 100 sites passed
  • This website is using a robots.txt file.
Sitemap Test74% of top 100 sites passed
  • This website has a sitemap file.
Looking for a Sitemap Generator Tool?

If you don't have a sitemap or the sitemap for your website is not up to date you can use our new Sitemap Generator tool.

Register for free, and start using today the Sitemap Generator from SEO Site Checkup Toolbox.

SEO Friendly URL Test25% of top 100 sites passed
  • All links from this webpage are SEO friendly.
Image Alt Test71% of top 100 sites passed
  • This webpage is using "img" tags with empty or missing "alt" attribute!
See full list
Responsive Image Test28% of top 100 sites passed
  • Not all images in this webpage are properly sized! This webpage is serving images that are larger than needed for the size of the user's viewport.
See results list
Image Aspect Ratio Test75% of top 100 sites passed
  • Not all image display dimensions match the natural aspect ratio! Fix aspect ratio issues to avoid distorted images on this website!
See results list
Inline CSS Test8% of top 100 sites passed
  • This webpage is using inline CSS styles!
See results list
Deprecated HTML Tags Test94% of top 100 sites passed
  • This webpage does not use HTML deprecated tags.
Google Analytics Test65% of top 100 sites passed
  • This webpage is using Google Analytics.
Favicon Test100% of top 100 sites passed
  • favicon
    This website appears to have a favicon.
JS Error Test79% of top 100 sites passed
  • There are no severe JavaScript errors on this webpage.
Console Errors Test41% of top 100 sites passed
  • This webpage has some warnings caught by the Chrome DevTools Console!
See results list
Charset Declaration Test100% of top 100 sites passed
  • This webpage has a character encoding declaration.
Content-Type: text/html; charset=utf-8
Social Media Test57% of top 100 sites passed
  • This webpage is connected successfully with social media using:
Facebook 
Speed optimizations
Score: 86
Failed: 4
Warnings: 0
Passed: 21
HTML Page Size Test21% of top 100 sites passed
DOM Size Test54% of top 100 sites passed
  • The Document Object Model (DOM) of this webpage has 1,139 nodes which is less than the recommended value of 1,500 nodes.
HTML Compression/GZIP Test97% of top 100 sites passed
  • This webpage is successfully compressed using br compression on your code. The HTML code is compressed from 265.8 Kb to 78.18 Kb (71% size savings). This helps ensure a faster loading webpage and improved user experience.
Site Loading Speed Test66% of top 100 sites passed
  • The loading time of this webpage (measured from N. Virginia, US) is around 3.69 seconds and this is under the average loading speed which is 5 seconds.
Accurate loading speed and website loading speed monitor

Get detailed and accurate loading speed reports for your websites and see how your pages are being loaded over time.

Register for free and use the Loading Speed Monitor from SEO Site Checkup Toolbox today and get valuable insights on how much time your customers need to wait until they see your page.

JS Execution Time Test71% of top 100 sites passed
  • The JavaScript code used by this webpage is executed in less than 2 seconds.
Page Objects Test
  • This webpage is using more than 20 http requests, which can slow down page loading and negatively impact user experience!
Content size by content type
Content type
Percent
Size
javascript
58.9 %
1.36 Mb
image
32.2 %
759.48 Kb
css
4.5 %
106.67 Kb
html
2.5 %
57.93 Kb
font
1.5 %
34.68 Kb
other
0.4 %
9.98 Kb
TOTAL
100%
2.30 Mb
Requests by content type
Content type
Percent
Requests
javascript
41.7 %
48
css
32.2 %
37
image
13.0 %
15
other
9.6 %
11
html
1.7 %
2
font
1.7 %
2
TOTAL
100%
115
Content size by domain
Domain
Percent
Size
touchedoutmama.co.uk
49.0 %
1.13 Mb
cdn.shopify.com
42.0 %
991.05 Kb
googletagmanager.com
3.5 %
82.64 Kb
connect.facebook.net
3.0 %
70.65 Kb
next.tizzy.tech
2.2 %
50.73 Kb
shop.app
0.1 %
2.84 Kb
api.ecomsend.com
0.1 %
2.00 Kb
cdn1.judge.me
0.0 %
830 B
facebook.com
0.0 %
273 B
merchant-center-analytics.goog
0.0 %
257 B
TOTAL
100%
2.30 Mb
Requests by domain
Domain
Percent
Requests
touchedoutmama.co.uk
73.9 %
85
cdn.shopify.com
16.5 %
19
shop.app
1.7 %
2
next.tizzy.tech
1.7 %
2
connect.facebook.net
1.7 %
2
googletagmanager.com
0.9 %
1
api.ecomsend.com
0.9 %
1
merchant-center-analytics.goog
0.9 %
1
facebook.com
0.9 %
1
cdn1.judge.me
0.9 %
1
TOTAL
100%
115
Page Cache Test (Server Side Caching)100% of top 100 sites passed
  • This webpage is using a caching mechanism. Caching helps speed page loading times as well as reduces server load.
Flash Test100% of top 100 sites passed
  • This webpage does not include flash objects (an outdated technology that was sometimes used to deliver rich multimedia content). Flash content does not work well on mobile devices, and is difficult for crawlers to interpret.
CDN Usage Test97% of top 100 sites passed
  • This webpage is serving all images, javascript and css resources from CDNs.
See results list
Modern Image Format Test38% of top 100 sites passed
  • This webpage is using images in a modern format.
Image Metadata Test72% of top 100 sites passed
  • This webpage is using images with large metadata (more than 16% of the image size)! Stripping out unnecessary metadata tags can improve not only the loading time but also the security and privacy of a webpage.
See results list
Image Caching Test97% of top 100 sites passed
  • This website is using cache headers for images and the browsers will display these images from the cache.
JavaScript Caching Test95% of top 100 sites passed
  • This webpage is using cache headers for all JavaScript resources.
CSS Caching Test96% of top 100 sites passed
  • This webpage is using cache headers for all CSS resources.
JavaScript Minification Test96% of top 100 sites passed
  • All JavaScript files used by this webpage are minified.
See results list
CSS Minification Test100% of top 100 sites passed
  • All CSS resources used by this webpage are minified.
See results list
Render Blocking Resources Test10% of top 100 sites passed
  • This webpage is using render blocking resources! Eliminating render-blocking resources can help this webpage to load significantly faster and will improve the website experience for your visitors.
See results list
Nested Tables Test99% of top 100 sites passed
  • This webpage is not using nested tables. This speeds up page loading time and optimizes the user experience.
Frameset Test100% of top 100 sites passed
  • This webpage does not use frames.
Doctype Test100% of top 100 sites passed
  • This webpage has a doctype declaration.
<!DOCTYPE html>
URL Redirects Test98% of top 100 sites passed
  • This URL doesn't have any redirects (which could potentially cause site indexation issues and site loading delays).
Time To First Byte Test98% of top 100 sites passed
  • The Time To First Byte value of this webpage is 0.138 seconds. To provide a good user experience, Google recommends that sites should strive to have a TTFB of 0.8 seconds or less.

0.138 s

0.8 s

1.8 s

First Contentful Paint Test94% of top 100 sites passed
  • The First Contentful Paint value of this webpage is 0.820 seconds. To provide a good user experience, Google recommends that sites should strive to have a First Contentful Paint value of 1.8 seconds or less.

0.82 s

1.8 s

3 s

Largest Contentful Paint Test90% of top 100 sites passed
  • The Largest Contentful Paint duration of this webpage is 2.12 seconds. To provide a good user experience, Google recommends that sites should strive to have Largest Contentful Paint of 2.5 seconds or less.

2.12 s

2.5 s

4 s

Largest Contentful Paint element within the viewport:
<img src="//touchedoutmama.co.uk/cdn/shop/files/20240425_122..." alt="touched out mama shop | Style to latch on to" srcset="//touchedoutmama.co.uk/cdn/shop/files/20240425_122..." width="1600" height="2000.0" sizes="100vw" fetchpriority="high">
Cumulative Layout Shift Test94% of top 100 sites passed
  • The CLS score of this webpage is 0.0000. To provide a good user experience, Google recommends that sites should strive to have a CLS score of 0.1 or less.
0
Server and security
Score: 93
Failed: 1
Warnings: 0
Passed: 9
URL Canonicalization Test97% of top 100 sites passed
SSL Checker and HTTPS Test100% of top 100 sites passed
  • This website is successfully using HTTPS, a secure communication protocol over the Internet.

The certificate is not used before the activation date.

The certificate has not expired.

The hostname "touchedoutmama.co.uk" is correctly listed in the certificate.

The certificate should be trusted by all major web browsers.

The certificate was not revoked.

The certificate was signed with a secure hash.

Certificate Chain:
Server certificate
Common name
touchedoutmama.co.uk
Subject Alternative Names (SANs)
touchedoutmama.co.uk
Not valid before
Fri, April 26o 2024, 7:47:45 pm (z)
Not valid after
Thu, July 25o 2024, 7:47:44 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
E1
Intermediate certificate
Common name
E1
Organization
Let's Encrypt
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 15o 2025, 4:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
ISRG Root X2
Root certificate
Common name
ISRG Root X2
Organization
Internet Security Research Group
Location
US
Not valid before
Fri, September 4o 2020, 12:00:00 am (z)
Not valid after
Mon, September 17o 2040, 4:00:00 pm (z)
Signature algorithm
ecdsaWithSha384
Issuer
ISRG Root X2
Mixed Content Test (HTTP over HTTPS)98% of top 100 sites passed
  • This webpage does not use mixed content - both the initial HTML and all other resources are loaded over HTTPS.
HTTP2 Test100% of top 100 sites passed
  • This webpage is using the HTTP/2 protocol.
HSTS Test82% of top 100 sites passed
  • This webpage is using the Strict-Transport-Security header.
strict-transport-security: max-age=7889238
Safe Browsing Test100% of top 100 sites passed
  • This website is not currently listed as suspicious (no malware or phishing activity found).
Server Signature Test98% of top 100 sites passed
  • The server signature is off for this webpage.
Directory Browsing Test100% of top 100 sites passed
  • Directory browsing is disabled for this website.
Plaintext Emails Test100% of top 100 sites passed
  • This webpage does not include email addresses in plaintext.
Mobile usability
Score: 100
Failed: 0
Warnings: 0
Passed: 3
Meta Viewport Test88% of top 100 sites passed
  • This webpage is using a viewport meta tag.
<meta name="viewport" content="width=device-width,initial-scale=1" />
Media Query Responsive Test98% of top 100 sites passed
  • This webpage is using CSS media queries, which is the base for responsive design functionalities.
Mobile Snapshot Test
Mobile view
Advanced SEO
Score: 98
Failed: 1
Warnings: 1
Passed: 8
Structured Data Test53% of top 100 sites passed
  • This webpage is using structured data.
See results list
Custom 404 Error Page Test67% of top 100 sites passed
  • This website is using a custom 404 error page. We recommend to have a custom 404 error page in order to improve the website's user experience by letting users know that only a specific page is missing/broken (and not the entire site), providing them helpful links, the opportunity to report bugs, and potentially track the source of broken links.
Noindex Tag Test98% of top 100 sites passed
  • This webpage does not use the noindex meta tag. This means that it can be indexed by search engines.
Canonical Tag Test93% of top 100 sites passed
  • This webpage is using the canonical link tag. This tag specifies that the URL: https://touchedoutmama.co.uk/ is preferred to be used in search results. Please ensure that this specification is correct, as canonical tags are often hard-coded and may not always reflect the latest changes in a site's URL structure.
<link href="https://touchedoutmama.co.uk/" rel="canonical"/>
Nofollow Tag Test
  • This webpage is using the nofollow meta tag! We recommend to use this tag carefully since search engines will not crawl all links from this webpage.
See results list
Disallow Directive Test
  • Your robots.txt file includes a disallow command which instructs search engines to avoid certain parts of your website! You are advised to confirm if access to these resources or pages are intended to be blocked (e.g., if they contain internal-only content or sensitive information).
See results list
Meta Refresh Test96% of top 100 sites passed
  • This webpage is not using a meta refresh tag.
SPF Records Test95% of top 100 sites passed
  • This DNS server is using an SPF record.
v=spf1 include:_spf-eu.ionos.com ~all
Ads.txt Validation Test68% of top 100 sites passed
  • This website doesn't use an ads.txt file! Ads.txt is a text file that contains a list of Authorized Digital Sellers. The purpose of ads.txt files is to give advertisers and advertising networks the ability to verify who is allowed to sell advertising on your website.
Spell Check Test
Check your webpage for misspellings!

Finding and fixing misspellings on your webpage will help both user experience and search engine rankings.


seo site checkup logo
Website SEO, Monitoring & Automation Made Easy.
Product
  • Pricing
  • Free Tools
  • Articles
  • Login
  • Free 7-Day Trial
© SEO Site Checkup 2020-2024 • All rights reserved